Comparing WP_011386786.1 NCBI__GCF_000009985.1:WP_011386786.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
47% identity, 91% coverage: 10:228/240 of query aligns to 2:220/220 of 8tzjA
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
47% identity, 85% coverage: 10:214/240 of query aligns to 1:205/222 of 8i6rB
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
48% identity, 84% coverage: 10:211/240 of query aligns to 1:202/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
48% identity, 84% coverage: 10:211/240 of query aligns to 1:202/219 of 8w6iD
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
47% identity, 85% coverage: 10:214/240 of query aligns to 1:205/218 of 8hd0A
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
40% identity, 90% coverage: 9:225/240 of query aligns to 2:217/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
40% identity, 90% coverage: 9:225/240 of query aligns to 2:217/230 of 6z4wA
A0A0H2ZM82 Cell division ATP-binding protein FtsE from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
40% identity, 90% coverage: 9:225/240 of query aligns to 2:217/230 of A0A0H2ZM82
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
45% identity, 83% coverage: 10:209/240 of query aligns to 2:202/225 of 8iddA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
45% identity, 83% coverage: 10:209/240 of query aligns to 1:201/229 of A5U7B7
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
45% identity, 83% coverage: 10:209/240 of query aligns to 2:202/227 of 8igqA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 79% coverage: 25:213/240 of query aligns to 19:208/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
43% identity, 79% coverage: 25:213/240 of query aligns to 20:209/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
43% identity, 79% coverage: 25:213/240 of query aligns to 20:209/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
43% identity, 79% coverage: 25:213/240 of query aligns to 20:209/344 of 6cvlD
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
44% identity, 76% coverage: 23:204/240 of query aligns to 15:197/223 of 2pclA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
43% identity, 75% coverage: 25:204/240 of query aligns to 21:201/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 85% coverage: 10:214/240 of query aligns to 1:213/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 85% coverage: 10:214/240 of query aligns to 1:213/230 of 1l2tA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
40% identity, 75% coverage: 25:204/240 of query aligns to 15:194/240 of 4ymuJ
Sites not aligning to the query:
>WP_011386786.1 NCBI__GCF_000009985.1:WP_011386786.1
MRHRPRGENIIRFDSVGLRYGLGPEVLQDVTFKLPAGSFHFLTGPSGAGKSSLLRLMYLG
LRPTRGRVVLFDRDIAATKRYELPALRRRIGVVFQDFRLLDHMTALDNVALPLRVRGVKE
SEIRRHVPELLSWVGLADHLGAKPSTLSGGQKQRVAIARAVIGRPDLLLADEPTGNVDDH
IAMRLMYLFEELNKLGTTIVVATHNELLVRRFAHLPRLHIEHGMVTTLHNEPVVDDLEAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory