Comparing WP_011386795.1 NCBI__GCF_000009985.1:WP_011386795.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
57% identity, 96% coverage: 2:281/291 of query aligns to 5:282/288 of 2ux8G
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
52% identity, 97% coverage: 2:284/291 of query aligns to 5:287/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
51% identity, 97% coverage: 2:282/291 of query aligns to 3:279/282 of 5ve7A
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
49% identity, 94% coverage: 1:273/291 of query aligns to 1:277/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
49% identity, 94% coverage: 1:273/291 of query aligns to 1:277/290 of 6k8dA
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
49% identity, 96% coverage: 2:281/291 of query aligns to 5:249/255 of 2ux8A
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
48% identity, 94% coverage: 1:273/291 of query aligns to 1:272/285 of 6ikzB
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
48% identity, 90% coverage: 2:263/291 of query aligns to 8:270/281 of 8f73E
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
45% identity, 96% coverage: 5:282/291 of query aligns to 5:284/291 of 8b6dA
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
41% identity, 90% coverage: 1:263/291 of query aligns to 1:256/265 of 3jukA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
41% identity, 90% coverage: 1:263/291 of query aligns to 1:256/264 of 3jukD
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
44% identity, 93% coverage: 2:272/291 of query aligns to 3:276/299 of 2pa4B
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
43% identity, 96% coverage: 5:282/291 of query aligns to 5:279/286 of 8b68A
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
29% identity, 83% coverage: 1:242/291 of query aligns to 2:213/295 of 6n0uA
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
28% identity, 81% coverage: 3:239/291 of query aligns to 2:208/293 of 5ifyA
Sites not aligning to the query:
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
30% identity, 82% coverage: 4:243/291 of query aligns to 2:211/289 of 4ho4A
Sites not aligning to the query:
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
30% identity, 82% coverage: 4:243/291 of query aligns to 2:211/294 of 4ho9A
Sites not aligning to the query:
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
30% identity, 82% coverage: 4:243/291 of query aligns to 2:211/288 of 4ho6A
Sites not aligning to the query:
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
30% identity, 82% coverage: 4:243/291 of query aligns to 2:211/288 of 4ho5A
Sites not aligning to the query:
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
30% identity, 82% coverage: 4:243/291 of query aligns to 2:211/288 of 4ho3A
Sites not aligning to the query:
>WP_011386795.1 NCBI__GCF_000009985.1:WP_011386795.1
MIRKAVLPVAGMGTRVLPATKVLPKELLPVVDKPLIQYAVEEAAEAGITEIVLVTARGKE
MLADHFDRNAELERSLETRGKTELLDIARSTCPKGVSITTVRQPAPLGLGHAVLCARPVI
GDEPFAVLLPDDLILGAPGCLKQLVDVWNETRGHVIAVENVPADQVDRYGILDVIEEKGR
LARARGLVEKPKPSEAPSTLSVIGRYVLDASVFDALERRERGAGGEIQLTDAIARTLGSV
PLHGARFHGTRYDCGNKAGYVAAIIDAALAHPETAAAVLAHLEALSGRRAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory