Comparing WP_011386835.1 NCBI__GCF_000009985.1:WP_011386835.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
46% identity, 97% coverage: 2:411/424 of query aligns to 1:409/418 of 4xg1B
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
43% identity, 92% coverage: 27:415/424 of query aligns to 13:398/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
43% identity, 92% coverage: 27:415/424 of query aligns to 11:390/394 of 3c5qA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
42% identity, 97% coverage: 2:411/424 of query aligns to 1:384/393 of 4xg1A
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
36% identity, 97% coverage: 7:418/424 of query aligns to 10:430/434 of 1tufA
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
36% identity, 97% coverage: 7:418/424 of query aligns to 10:430/434 of 1twiA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
36% identity, 97% coverage: 7:418/424 of query aligns to 14:434/438 of Q58497
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
35% identity, 97% coverage: 7:417/424 of query aligns to 9:422/422 of 6n2aA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
36% identity, 93% coverage: 18:411/424 of query aligns to 4:380/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
36% identity, 93% coverage: 18:411/424 of query aligns to 3:379/385 of 2yxxA
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
34% identity, 94% coverage: 10:407/424 of query aligns to 10:409/419 of 1ko0A
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
34% identity, 94% coverage: 10:407/424 of query aligns to 11:410/420 of P00861
1knwA Crystal structure of diaminopimelate decarboxylase
34% identity, 94% coverage: 10:407/424 of query aligns to 10:409/421 of 1knwA
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
30% identity, 96% coverage: 4:411/424 of query aligns to 23:451/461 of 8d5rA
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
30% identity, 98% coverage: 2:415/424 of query aligns to 16:442/442 of 5x7nA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
30% identity, 98% coverage: 2:416/424 of query aligns to 16:443/443 of 5x7mA
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
30% identity, 93% coverage: 18:411/424 of query aligns to 8:406/412 of 7ru7A
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
30% identity, 96% coverage: 4:411/424 of query aligns to 22:449/458 of 8d5dA
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
30% identity, 96% coverage: 4:411/424 of query aligns to 23:453/462 of 8d4iA
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
30% identity, 96% coverage: 4:411/424 of query aligns to 23:453/461 of 8d88A
>WP_011386835.1 NCBI__GCF_000009985.1:WP_011386835.1
MNHFHYQNGELFAEDVAIARIAREVGTPFYCYSTATLQRHYTVFAEALKAAGLDATICFA
AKANPNMAVIRTFAQLGAGADVVSEGELRQALAAGVPAARIVFSGVGKTRHELEFAVAKG
IFQINVESEPELEMLSEIAAARGQVMPIAIRVNPDVDAGTHAKITTGKKENKFGIEWTRA
REVYARAKALPGVEPVAIACHIGSQLTELTPFREAFLRVRDLVAMLRADGIDIRRLDLGG
GLGVPYDDETPPEPAAYAEVIKATLGDLGCRFVFEPGRLLVGNAGILVSRIIRVKEGSTR
TFLIVDAAMNDLARPSLYDAYHSIFPVAEPKAGAALAEVDVVGPVCETGDTFAKQRRLPP
MRTDDLLAFGTAGAYGAAMSSTYNTRPLIPEVLVKGGDYAVIRVRPSYEDMRSLESLPGW
LNDE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory