Comparing WP_011386874.1 NCBI__GCF_000009985.1:WP_011386874.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
50% identity, 61% coverage: 7:72/109 of query aligns to 113:178/200 of 6j2lA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
41% identity, 61% coverage: 7:72/109 of query aligns to 106:163/185 of 6j2lB
Sites not aligning to the query:
>WP_011386874.1 NCBI__GCF_000009985.1:WP_011386874.1
MAQDSKILEELYTVIASRKGTDPDKSYTAKLFARGRGKIAQKFGEEAVETVVAALSEGKD
ELVGESADTLYHLLVLWADCGVEPAKVWAELARRTGTSGIDEKKSRAKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory