Comparing WP_011423566.1 NCBI__GCF_000092045.1:WP_011423566.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
36% identity, 91% coverage: 16:325/341 of query aligns to 5:313/320 of 1sz2B
6da0A Crystal structure of glucokinase (nfhk) from naegleria fowleri (see paper)
24% identity, 78% coverage: 7:273/341 of query aligns to 19:318/378 of 6da0A
Sites not aligning to the query:
>WP_011423566.1 NCBI__GCF_000092045.1:WP_011423566.1
MPKSNHSTAPLPFPILIGDIGGTNARFSILTDAYAEPKQFPNVRTADFATIDEAIQKGVL
DKTAVQPRSAILAVAGPINDDEIPLTNCAWVVRPKTMIEGLGIEDVLVVNDFEAQALAIA
ALSDENRERIGSATGDMVASRVVLGPGTGLGVGGLVHAQHTWIPVPGEGGHIDLGPRSKR
DYEIFPHIETIEGRVSAEQILCGRGLVNLYNAICVVDGIQPTMKDPADITSHALDGSDKV
AVETVSLFATYLGRVAGDMAMVFMARGGVYLSGGISQKIIPALKKPEFRQAFEDKAPHSA
LLRTIPTYVVTHPLAALAGLSSYARMPANFGVSTEGRRWRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory