Comparing WP_011426329.1 NCBI__GCF_000092045.1:WP_011426329.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
73% identity, 93% coverage: 22:364/367 of query aligns to 1:343/345 of 4n0qB
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
47% identity, 92% coverage: 23:361/367 of query aligns to 2:338/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
47% identity, 92% coverage: 23:361/367 of query aligns to 2:338/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
47% identity, 92% coverage: 23:361/367 of query aligns to 2:338/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
47% identity, 92% coverage: 23:361/367 of query aligns to 2:338/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
47% identity, 92% coverage: 23:361/367 of query aligns to 2:338/348 of 3ipcA
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
43% identity, 92% coverage: 23:359/367 of query aligns to 2:335/344 of 1z18A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
43% identity, 92% coverage: 23:359/367 of query aligns to 2:335/344 of 1z16A
1uskA L-leucine-binding protein with leucine bound (see paper)
41% identity, 92% coverage: 23:359/367 of query aligns to 2:337/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
41% identity, 92% coverage: 23:359/367 of query aligns to 2:337/345 of 1usiA
9jtiA X-ray structure of neile indicator complexed with isoleucine (see paper)
43% identity, 90% coverage: 28:359/367 of query aligns to 233:561/570 of 9jtiA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
34% identity, 88% coverage: 24:347/367 of query aligns to 2:324/350 of 3td9A
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
31% identity, 77% coverage: 24:307/367 of query aligns to 3:288/348 of 4gnrA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
32% identity, 50% coverage: 35:219/367 of query aligns to 10:194/335 of 4q6bA
Sites not aligning to the query:
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
32% identity, 50% coverage: 35:219/367 of query aligns to 10:194/336 of 4mlcA
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
28% identity, 83% coverage: 24:328/367 of query aligns to 4:331/376 of 4q6wA
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
30% identity, 77% coverage: 24:306/367 of query aligns to 3:289/364 of 4rdcA
Sites not aligning to the query:
4qymA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with methionine
30% identity, 77% coverage: 24:306/367 of query aligns to 3:289/364 of 4qymA
Sites not aligning to the query:
4otzA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with cystein
30% identity, 77% coverage: 24:306/367 of query aligns to 3:289/364 of 4otzA
Sites not aligning to the query:
4og2A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with leucine
30% identity, 77% coverage: 24:306/367 of query aligns to 3:289/364 of 4og2A
Sites not aligning to the query:
>WP_011426329.1 NCBI__GCF_000092045.1:WP_011426329.1
MTLKTLTATLVASLAFAPLAHADIAIGLIAPLTGPVAAYGDQVKNGAQTAVDEINKKGGI
LGEKVVLELADDAGEPKQGVSAANKVVGDGIRFVVGPVTSGVAIPVSDVLAENGVLMVTP
TATAPDLTKRGLANVLRTCGRDDQQAEVAAKYVLKNFKDKRIAIVNDKGAYGKGLADAFK
ATLNAGGITEVVNDAITPGDKDFSALTTRIKSEKVDIVYFGGYHPEGGLLARQLHDLSAN
AMIIGGDGLSNTEFWAIGTDAAAGTLFTNASDATKNPDSKAAAEALTAKNIPAEAFTLNA
YAAVEVLKAGIEKAGSAEDAEAVAAALKGGMEVPTAIGKLTYGETGDLTSQSFSLYKWEG
GKIVAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory