Comparing WP_011601969.1 NCBI__GCF_000058485.1:WP_011601969.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 79% coverage: 18:270/320 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 79% coverage: 18:270/320 of query aligns to 4:253/253 of 1g9xB
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
30% identity, 80% coverage: 16:271/320 of query aligns to 4:239/240 of 1ji0A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 75% coverage: 18:258/320 of query aligns to 1:223/240 of 4ymuJ
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 79% coverage: 18:270/320 of query aligns to 2:235/240 of 6mjpA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 78% coverage: 21:270/320 of query aligns to 5:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 78% coverage: 21:270/320 of query aligns to 5:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 78% coverage: 21:270/320 of query aligns to 5:235/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 78% coverage: 21:270/320 of query aligns to 6:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 78% coverage: 21:269/320 of query aligns to 5:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 78% coverage: 21:269/320 of query aligns to 5:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
31% identity, 78% coverage: 21:268/320 of query aligns to 5:233/233 of 6b8bA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
28% identity, 76% coverage: 18:261/320 of query aligns to 3:229/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
28% identity, 76% coverage: 18:261/320 of query aligns to 3:229/230 of 6z4wA
A0A0H2ZM82 Cell division ATP-binding protein FtsE from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
28% identity, 76% coverage: 18:261/320 of query aligns to 3:229/230 of A0A0H2ZM82
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 77% coverage: 18:262/320 of query aligns to 3:229/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 77% coverage: 18:262/320 of query aligns to 3:229/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 77% coverage: 18:262/320 of query aligns to 3:229/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 77% coverage: 18:262/320 of query aligns to 3:229/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 75% coverage: 18:258/320 of query aligns to 2:223/241 of 4u00A
>WP_011601969.1 NCBI__GCF_000058485.1:WP_011601969.1
MPGARRPRADETAPGDLVVEARDLALRFGGVTSLDGVSLRQRRGEILAVIGPNGAGKTSL
FNCLTGAYRPQEGSVTFWPRPDGPTELVGRRPHAITRLGVARTFQNIRLFPALSALENVQ
IGTEVRQRYGPVGAILGLPHARRAERDGVRHALSLLDLVGLSHRTHELAASLPYGEQRRL
EIARALGTGPSLLLLDEPAAGTNPAEKRDLAALITRIAGTGVSVLLIEHDMRLVMSVATS
VVVLNFGRVIAHGTPGEVQRDPAVIEAYLGVTDAEATAGDVDVTAGPGARPGARPGARPG
ARPGVGPGVGPGAVVRKDLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory