Comparing WP_011606115.1 NCBI__GCF_000058485.1:WP_011606115.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
56% identity, 91% coverage: 22:385/402 of query aligns to 3:361/369 of 4r8dA
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
52% identity, 91% coverage: 23:386/402 of query aligns to 2:360/364 of 3cq6A
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
52% identity, 91% coverage: 23:386/402 of query aligns to 4:362/366 of 3cq5B
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
37% identity, 87% coverage: 30:379/402 of query aligns to 5:343/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
37% identity, 87% coverage: 30:379/402 of query aligns to 5:343/353 of 4r2nA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
29% identity, 89% coverage: 30:385/402 of query aligns to 4:359/360 of 8bj3A
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 86% coverage: 39:382/402 of query aligns to 7:325/328 of 1uu0A
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
30% identity, 86% coverage: 39:382/402 of query aligns to 14:332/335 of 2f8jA
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 86% coverage: 39:382/402 of query aligns to 8:326/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
30% identity, 86% coverage: 39:382/402 of query aligns to 8:326/329 of 1h1cA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 86% coverage: 39:382/402 of query aligns to 13:331/335 of Q9X0D0
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
30% identity, 88% coverage: 31:382/402 of query aligns to 9:349/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
30% identity, 88% coverage: 31:382/402 of query aligns to 9:349/354 of 1fg3A
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
32% identity, 88% coverage: 31:382/402 of query aligns to 9:349/353 of 7szpA
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
30% identity, 83% coverage: 49:382/402 of query aligns to 16:335/335 of 1geyA
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
29% identity, 84% coverage: 40:376/402 of query aligns to 10:339/354 of 3ly1D
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
29% identity, 84% coverage: 51:386/402 of query aligns to 36:365/369 of 4wbtA
P0DV65 L-serine phosphate decarboxylase; CobD homolog SMUL_1544; SmCobD; L-serine O-phosphate decarboxylase; L-Ser-P decarboxylase; Norcobamide biosynthesis protein SMUL_1544; Threonine phosphate decarboxylase-like enzyme; EC 4.1.1.- from Sulfurospirillum multivorans (strain DM 12446 / JCM 15788 / NBRC 109480) (see paper)
23% identity, 71% coverage: 106:389/402 of query aligns to 96:391/392 of P0DV65
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
27% identity, 65% coverage: 90:351/402 of query aligns to 71:356/399 of 5wmhA
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
27% identity, 65% coverage: 90:351/402 of query aligns to 71:356/402 of 5wmiA
Sites not aligning to the query:
>WP_011606115.1 NCBI__GCF_000058485.1:WP_011606115.1
MTIQASHPAEAGPAGDDRPWRPLDIDGLPLRDSLRGLSPYGAPQLDVPVLLNTNENPHPP
SIGLVDALGKAATLVATEANRYPDRDAEALRADLAYYLTPDAGFGVHTAQVWAANGSNEI
LQQLCQAFGGPGRVAVGFEPSYSMHRLIALATATEWVREERAADFTLSAETVTAAVERHR
PALLFLCSPNNPTGTALPLDVVVAACEAMARVGSGMVVVDEAYAEFRRAGVPSALTLLPR
HPRLIVTRTMSKAFALAGARVGYLAAHPAVVDALQLVRLPYHLSSFTQAVARTALAHADE
LLATVEAVKAQRDRIVVELGALGLRLAPSDANFVFFGLFADQRAVWRGLLDAGVLVRDVG
LPGWLRVTAGLPAEVDAFLAALGRVLAGSDVAADGIVTLAGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory