Comparing WP_011606147.1 NCBI__GCF_000058485.1:WP_011606147.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
41% identity, 90% coverage: 5:234/256 of query aligns to 6:238/240 of 1ji0A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 90% coverage: 4:234/256 of query aligns to 1:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 90% coverage: 4:234/256 of query aligns to 1:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 90% coverage: 4:234/256 of query aligns to 1:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 91% coverage: 3:234/256 of query aligns to 1:236/241 of 6mbnA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 91% coverage: 4:236/256 of query aligns to 1:237/240 of 6mjpA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 85% coverage: 4:221/256 of query aligns to 1:223/233 of 6b8bA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 85% coverage: 4:221/256 of query aligns to 1:223/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 85% coverage: 4:221/256 of query aligns to 1:223/234 of 4p31A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 85% coverage: 5:221/256 of query aligns to 1:223/240 of 4ymuJ
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 84% coverage: 5:218/256 of query aligns to 4:224/280 of 5x40A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
27% identity, 88% coverage: 5:230/256 of query aligns to 4:240/285 of 4yerA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 85% coverage: 5:221/256 of query aligns to 2:223/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 91% coverage: 3:234/256 of query aligns to 15:249/378 of P69874
Sites not aligning to the query:
8y5iA Cryo-em structure of e.Coli spermidine transporter potd-potabc in translocation intermidiate state (see paper)
28% identity, 93% coverage: 5:241/256 of query aligns to 2:241/358 of 8y5iA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
23% identity, 88% coverage: 2:227/256 of query aligns to 1:238/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
23% identity, 88% coverage: 2:227/256 of query aligns to 1:238/254 of 1g6hA
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
28% identity, 91% coverage: 6:237/256 of query aligns to 7:233/353 of 1vciA
8wm7C Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
29% identity, 79% coverage: 21:221/256 of query aligns to 23:224/658 of 8wm7C
Sites not aligning to the query:
8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
29% identity, 82% coverage: 20:229/256 of query aligns to 23:238/257 of 8wm7D
Sites not aligning to the query:
>WP_011606147.1 NCBI__GCF_000058485.1:WP_011606147.1
MTAAIIDCAGLTSGYAGVPVIRDLDLTVGEGELVAVLGPNGAGKTTTLLTIAGVLRPIGG
AVRFLGAPVDGGRPDRVARRGLCLVPDDRSVFFDLTVRENIRMGRGRRHGDPVRVVLDYF
PALESRLRMRAGLLSGGEQQMLAIGRAITMRPRALMVDEMSLGLAPVIVKKLLPVMRRIA
DDLGCAILIVEQHVDLALQVVDRAYVFNHGAMVQEGPAVELRGQRDLIEASYLGAQDAPD
AQTDQADQADQGGAVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory