Comparing WP_011651165.1 NCBI__GCF_000009265.1:WP_011651165.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
60% identity, 98% coverage: 8:453/455 of query aligns to 4:449/450 of 6gwiB
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
58% identity, 97% coverage: 13:453/455 of query aligns to 8:442/443 of 7qx0B
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
58% identity, 93% coverage: 33:453/455 of query aligns to 1:421/422 of 7qx3A
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
55% identity, 98% coverage: 8:454/455 of query aligns to 3:449/453 of 6s4gA
7q9xAAA Probable aminotransferase
55% identity, 98% coverage: 8:454/455 of query aligns to 4:450/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
55% identity, 98% coverage: 8:454/455 of query aligns to 4:450/455 of 4a6tC
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
54% identity, 98% coverage: 8:454/455 of query aligns to 4:452/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
54% identity, 98% coverage: 8:454/455 of query aligns to 4:452/455 of 7ypnD
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
55% identity, 93% coverage: 33:454/455 of query aligns to 1:422/427 of 4ba5A
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
55% identity, 91% coverage: 34:447/455 of query aligns to 1:377/384 of 5ti8B
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
54% identity, 93% coverage: 34:454/455 of query aligns to 1:418/423 of 4a6rA
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 100% coverage: 1:453/455 of query aligns to 3:460/460 of 5kr6B
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
42% identity, 95% coverage: 3:436/455 of query aligns to 1:433/448 of 6io1B
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
41% identity, 97% coverage: 8:447/455 of query aligns to 1:443/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
41% identity, 97% coverage: 8:447/455 of query aligns to 1:443/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
41% identity, 97% coverage: 8:447/455 of query aligns to 1:443/453 of 6g4dB
5ghgB Transaminase w58l with smba
43% identity, 95% coverage: 7:438/455 of query aligns to 1:416/433 of 5ghgB
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
42% identity, 96% coverage: 9:447/455 of query aligns to 4:450/455 of 5kr5A
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
42% identity, 98% coverage: 9:453/455 of query aligns to 7:457/458 of 5kr3A
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
40% identity, 94% coverage: 19:446/455 of query aligns to 14:444/459 of D6R3B6
>WP_011651165.1 NCBI__GCF_000009265.1:WP_011651165.1
MPDTYPPSNLAAIDAAHHLHPFADMKKLNAEGARIIQRGEGVYIFDNHGRKYLDGFAGLW
CVNIGYGRREIADAATRQMNELPYYNTFFGTTSTPATLLAQKVTSHAGERFNHIFFTGSG
SEANDTWFRMARVYWSAVGKSSKKIVISRKNGYHGSTVAGASLGGMKYMHEQGDLPIPGI
VHIGQPYWYGEGGDLSPAEFGLKVARELEAKIDELGEENVAAFVAEPVQGAAGVIIPPET
YWREIDRICKARNILLVTDEVICGFGRLGAWFGHQYFGVEPDLAPIAKGLSSGYLPIGGV
LVSDRVADVLINEVGDFNHGFTYSGHPVCAAAALENLRIIEEERLVERVRDDIGPYFGKA
WAALADHDLVGEAVSIGLMGGLQLAAEKSTRTRYAKPDQVGALVRNHALANGLVLRATGD
RMLASPPLVISHAEVDEMARITRLALDLAWKELKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory