Comparing WP_011651801.1 NCBI__GCF_000009265.1:WP_011651801.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
74% identity, 94% coverage: 23:341/341 of query aligns to 4:324/324 of 4z9nB
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
30% identity, 61% coverage: 27:234/341 of query aligns to 3:204/231 of 2v25A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
30% identity, 62% coverage: 33:242/341 of query aligns to 3:205/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
30% identity, 62% coverage: 33:242/341 of query aligns to 3:203/225 of 4zv2A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
28% identity, 64% coverage: 25:242/341 of query aligns to 1:208/229 of 5t0wA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
27% identity, 63% coverage: 12:227/341 of query aligns to 29:236/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
27% identity, 63% coverage: 12:227/341 of query aligns to 29:236/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
27% identity, 63% coverage: 12:227/341 of query aligns to 30:237/288 of 6h2tA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
26% identity, 65% coverage: 21:242/341 of query aligns to 1:214/251 of 1xt8B
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
28% identity, 54% coverage: 58:242/341 of query aligns to 38:214/243 of 5eyfB
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
24% identity, 66% coverage: 19:244/341 of query aligns to 1:228/278 of 2ia4B
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 65% coverage: 24:244/341 of query aligns to 1:210/247 of 2yjpA
2vhaA Debp (see paper)
24% identity, 65% coverage: 22:244/341 of query aligns to 3:227/276 of 2vhaA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 63% coverage: 27:241/341 of query aligns to 3:206/229 of 6svfA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
24% identity, 65% coverage: 22:244/341 of query aligns to 1:225/503 of 8ovoA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
25% identity, 65% coverage: 33:255/341 of query aligns to 3:216/234 of 3k4uE
9e2bC Structure of a solute binding protein from desulfonauticus sp. Bound to l-tryptophan
25% identity, 67% coverage: 17:243/341 of query aligns to 10:230/258 of 9e2bC
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
24% identity, 58% coverage: 1:198/341 of query aligns to 1:184/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
23% identity, 48% coverage: 36:198/341 of query aligns to 3:159/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
23% identity, 48% coverage: 36:198/341 of query aligns to 6:162/238 of 1lstA
>WP_011651801.1 NCBI__GCF_000009265.1:WP_011651801.1
MKNKLLSAAIGAAVLAVGASAASATTLSDVKAKGFVQCGVNTGLTGFAAPDASGNWAGFD
VDFCKAVASAVFGDPTKVKYTPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNFRP
VTYYDGQGFMVRKGLNVKSALELSGAAICVQSGTTTELNLADYFKTNNLQYNPVVFENLP
EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHIILPEIISKEPLGPAVRQGDDQWFDI
VSWTAYALINAEEFGITQANVDEMKNSPNPDIKRFLGSETDTKIGTDLGLTNDWAANVIK
GVGNYGEIFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory