Comparing WP_011654321.1 NCBI__GCF_000009265.1:WP_011654321.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6aq4B Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
37% identity, 100% coverage: 1:277/278 of query aligns to 1:268/268 of 6aq4B
6as5A Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, acetoacetate and coenzyme a (see paper)
38% identity, 97% coverage: 7:277/278 of query aligns to 9:266/267 of 6as5A
6arbA Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and coenzyme a (see paper)
38% identity, 97% coverage: 7:277/278 of query aligns to 10:267/268 of 6arbA
6aq4C Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
38% identity, 96% coverage: 7:273/278 of query aligns to 11:264/267 of 6aq4C
8wcoA (S)-citramalyl-coa lyase (see paper)
38% identity, 99% coverage: 3:277/278 of query aligns to 6:272/275 of 8wcoA
8khlA (S)-citramalyl-coa lyase (see paper)
38% identity, 99% coverage: 3:277/278 of query aligns to 6:272/275 of 8khlA
5vxcA Crystal structure analysis of human clybl in complex with free coash (see paper)
29% identity, 96% coverage: 4:269/278 of query aligns to 7:288/301 of 5vxcA
5vxoA Crystal structure analysis of human clybl in complex with propionyl- coa (see paper)
29% identity, 96% coverage: 4:269/278 of query aligns to 7:288/298 of 5vxoA
Q8N0X4 Citramalyl-CoA lyase, mitochondrial; (3S)-malyl-CoA thioesterase; Beta-methylmalate synthase; Citrate lyase subunit beta-like protein; Citrate lyase beta-like; Malate synthase; EC 4.1.3.25; EC 3.1.2.30; EC 2.3.3.-; EC 2.3.3.9 from Homo sapiens (Human) (see 5 papers)
29% identity, 96% coverage: 4:269/278 of query aligns to 46:327/340 of Q8N0X4
Sites not aligning to the query:
4l9yC Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
32% identity, 97% coverage: 4:273/278 of query aligns to 14:309/316 of 4l9yC
Q3J5L6 L-malyl-CoA/beta-methylmalyl-CoA lyase; (3S)-malyl-CoA/beta-methylmalyl-CoA lyase; (S)-citramalyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
32% identity, 97% coverage: 4:273/278 of query aligns to 15:310/318 of Q3J5L6
4l9yA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
32% identity, 97% coverage: 4:273/278 of query aligns to 14:309/314 of 4l9yA
4l9zA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa (see paper)
32% identity, 97% coverage: 4:273/278 of query aligns to 13:308/313 of 4l9zA
5ugrA Malyl-coa lyase from methylobacterium extorquens (see paper)
28% identity, 97% coverage: 4:274/278 of query aligns to 14:315/323 of 5ugrA
1u5vA Structure of cite complexed with triphosphate group of atp form mycobacterium tuberculosis
35% identity, 72% coverage: 28:228/278 of query aligns to 31:221/223 of 1u5vA
Q9RUZ0 Citrate lyase subunit beta-like protein; EC 4.1.-.- from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
33% identity, 97% coverage: 3:273/278 of query aligns to 8:280/284 of Q9RUZ0
1sgjB Crystal structure of citrate lyase beta subunit
33% identity, 81% coverage: 3:228/278 of query aligns to 5:230/231 of 1sgjB
1sgjA Crystal structure of citrate lyase beta subunit
33% identity, 81% coverage: 3:228/278 of query aligns to 5:230/231 of 1sgjA
S5N020 Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; (3S)-citramalyl-CoA pyruvate-lyase; (S)-citramalyl-CoA lyase; Erythro-beta-methylmalyl-CoA; L-malyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Chloroflexus aurantiacus (see paper)
27% identity, 92% coverage: 21:276/278 of query aligns to 48:332/348 of S5N020
4l80C Crystal structure of chloroflexus aurantiacus malyl-coa lyase in complex with magnesium, oxalate, and propionyl-coa (see paper)
27% identity, 92% coverage: 21:276/278 of query aligns to 47:331/347 of 4l80C
Sites not aligning to the query:
>WP_011654321.1 NCBI__GCF_000009265.1:WP_011654321.1
MRLRSLLFIPGDRPERFEKALASGADAVILDLEDSVAPLNKPKARESVHEFILHHAGETP
LLIRINPLASPEFESDLAALSGLHPFAIVLPKAEGAASVLKLAGSLASAIPILPIATETP
SAIFEIGSYRDVSTSLCGLTWGAEDLPAAMGATTARRTDGRYTPPYELARSLTLFGAHAA
AVPAIDTVYPDFHDLNGLRAYVGRARRDGFSGMMAIHPSQVEVINHAFTPDASEVAWAEK
VAAAFAARPDAGVIQLDGRMLDLPHLKLALRILEISGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory