Comparing WP_011763948.1 NCBI__GCF_000061505.1:WP_011763948.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
40% identity, 98% coverage: 2:452/460 of query aligns to 1:455/455 of 5kr5A
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
39% identity, 98% coverage: 3:451/460 of query aligns to 6:458/460 of 5kr6B
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
38% identity, 94% coverage: 5:438/460 of query aligns to 2:427/443 of 6fyqA
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
38% identity, 98% coverage: 2:451/460 of query aligns to 4:455/458 of 5kr3A
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
38% identity, 97% coverage: 9:452/460 of query aligns to 8:441/443 of 7qx0B
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
38% identity, 97% coverage: 4:449/460 of query aligns to 5:454/459 of 5kquC
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
38% identity, 98% coverage: 1:449/460 of query aligns to 1:445/450 of 6gwiB
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
39% identity, 99% coverage: 6:459/460 of query aligns to 3:454/454 of 7ypmA
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
38% identity, 97% coverage: 4:449/460 of query aligns to 1:445/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
38% identity, 97% coverage: 4:449/460 of query aligns to 1:445/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
38% identity, 97% coverage: 4:449/460 of query aligns to 1:445/453 of 6g4dB
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
39% identity, 90% coverage: 37:452/460 of query aligns to 8:420/422 of 7qx3A
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
39% identity, 98% coverage: 1:450/460 of query aligns to 3:457/458 of 3fcrA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
38% identity, 99% coverage: 6:459/460 of query aligns to 3:454/455 of 7ypnD
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
39% identity, 97% coverage: 6:451/460 of query aligns to 8:448/448 of 6io1B
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
37% identity, 94% coverage: 3:434/460 of query aligns to 6:441/458 of 3gjuA
7q9xAAA Probable aminotransferase
38% identity, 97% coverage: 2:448/460 of query aligns to 2:444/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
38% identity, 97% coverage: 2:448/460 of query aligns to 2:444/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
38% identity, 97% coverage: 2:448/460 of query aligns to 1:443/453 of 6s4gA
5ghgB Transaminase w58l with smba
37% identity, 92% coverage: 25:449/460 of query aligns to 23:427/433 of 5ghgB
Sites not aligning to the query:
>WP_011763948.1 NCBI__GCF_000061505.1:WP_011763948.1
MTTDALLDLDRKHLIHPVAAWRGHEQRGTTVLASGHDGVWLRDIHGKEVLDAFAGLWCVN
IGYGHESVVQAAAEQMRKLPYATGYFGFGSEPAIRLAAKLAEIAPKSLRHTYLTLGGSEA
VDAAIRLITHYYNATGRPQKKHFIAIERGYHGSSSVGSGLTALPAFHRGFDVPLPNQHYI
ASPYPYRSPVGDDPQAVIAASVAALRAKVAELGADNVAAFFCEPVQGSGGVIVPPKGWLK
AMREASRELGILFVVDEVITGFGRTGPMFACLAEDVEPDLMTMAKGLTSGYVPMGALMIS
DEVYNGIADGAAPNVLVGHGATYSGHPVSAAVALEVIRLYEEGGILAHAQAMEPGFAAGL
GEMLDHPLVGDVRHRGLLGAVELVADKASKRAFDPALGLADRLFRSGYQNGLIFRSFGDH
ILGFAPALCFTEDNFAQLFARLKRTLDEVLDAPDVRRALA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory