SitesBLAST
Comparing WP_011764560.1 NCBI__GCF_000061505.1:WP_011764560.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
38% identity, 79% coverage: 66:315/316 of query aligns to 77:334/336 of 5z20F
- active site: S108 (≠ A97), R241 (= R233), D265 (= D257), E270 (= E262), H302 (= H283)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y96), G160 (= G155), Q161 (≠ G156), I162 (≠ L157), Y180 (≠ A175), D181 (≠ E176), P182 (vs. gap), C212 (= C204), P213 (= P205), T218 (= T210), T239 (= T231), G240 (≠ A232), R241 (= R233), H302 (= H283), A304 (= A285)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
36% identity, 87% coverage: 34:309/316 of query aligns to 36:314/334 of 5aovA
- active site: L100 (≠ A97), R241 (= R233), D265 (= D257), E270 (= E262), H288 (= H283)
- binding glyoxylic acid: M52 (≠ K51), L53 (= L52), L53 (= L52), Y74 (≠ A71), A75 (= A72), V76 (≠ T73), G77 (= G74), R241 (= R233), H288 (= H283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T73), T104 (≠ V101), F158 (≠ R154), G159 (= G155), R160 (≠ G156), I161 (≠ L157), S180 (≠ E176), R181 (≠ H177), A211 (≠ H203), V212 (≠ C204), P213 (= P205), T218 (= T210), I239 (≠ T231), A240 (= A232), R241 (= R233), H288 (= H283), G290 (≠ A285)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
30% identity, 85% coverage: 41:309/316 of query aligns to 40:320/334 of 3kb6B
- active site: S97 (≠ A97), R231 (= R233), D255 (= D257), E260 (= E262), H294 (= H283)
- binding lactic acid: F49 (≠ I49), S72 (≠ A72), V73 (≠ T73), G74 (= G74), Y96 (= Y96), R231 (= R233), H294 (= H283)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ T73), Y96 (= Y96), V101 (= V101), G150 (= G155), R151 (≠ G156), I152 (≠ L157), D171 (≠ E176), V172 (≠ H177), P203 (= P205), T229 (= T231), A230 (= A232), R231 (= R233), H294 (= H283), A296 (= A285), Y297 (≠ W286)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
33% identity, 90% coverage: 26:309/316 of query aligns to 26:304/304 of 1wwkA
- active site: S96 (≠ A97), R230 (= R233), D254 (= D257), E259 (= E262), H278 (= H283)
- binding nicotinamide-adenine-dinucleotide: V100 (= V101), G146 (= G153), F147 (≠ R154), G148 (= G155), R149 (≠ G156), I150 (≠ L157), Y168 (vs. gap), D169 (vs. gap), P170 (vs. gap), V201 (≠ C204), P202 (= P205), T207 (= T210), T228 (= T231), S229 (≠ A232), D254 (= D257), H278 (= H283), G280 (≠ A285)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
33% identity, 86% coverage: 28:299/316 of query aligns to 26:293/297 of 6rj3A
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
33% identity, 86% coverage: 28:299/316 of query aligns to 27:294/301 of 6rj5A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
33% identity, 86% coverage: 28:299/316 of query aligns to 26:293/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ A97), A100 (≠ V101), R149 (≠ G156), I150 (≠ L157), Y168 (vs. gap), D169 (vs. gap), P170 (vs. gap), I171 (≠ V172), H200 (= H203), T201 (≠ C204), P202 (= P205), T207 (= T210), C228 (≠ T231), A229 (= A232), R230 (= R233), H277 (= H283), G279 (≠ A285)
7dkmA Phgdh covalently linked to oridonin (see paper)
33% identity, 86% coverage: 28:299/316 of query aligns to 28:295/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T73), A102 (≠ V101), G148 (= G153), R151 (≠ G156), I152 (≠ L157), Y170 (vs. gap), D171 (vs. gap), P172 (vs. gap), I173 (≠ V172), H202 (= H203), T203 (≠ C204), P204 (= P205), T209 (= T210), C230 (≠ T231), A231 (= A232), R232 (= R233), H279 (= H283), G281 (≠ A285)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ D297)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 86% coverage: 28:299/316 of query aligns to 27:294/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 86% coverage: 28:299/316 of query aligns to 28:295/305 of 6plfA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
33% identity, 86% coverage: 28:299/316 of query aligns to 24:291/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G155), I148 (≠ L157), Y166 (vs. gap), D167 (vs. gap), P168 (vs. gap), I169 (≠ V172), I170 (= I173), H198 (= H203), T199 (≠ C204), L208 (= L213), R228 (= R233)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
33% identity, 86% coverage: 28:299/316 of query aligns to 27:294/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ I152), G147 (= G153), L148 (≠ R154), G149 (= G155), R150 (≠ G156), I151 (≠ L157), G152 (= G158), D170 (vs. gap), H201 (= H203), T202 (≠ C204), P203 (= P205)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
33% identity, 86% coverage: 28:299/316 of query aligns to 27:294/302 of 6rihA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
33% identity, 84% coverage: 33:299/316 of query aligns to 37:299/533 of O43175
- T78 (= T73) binding
- R135 (= R130) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ GL 156:157) binding
- D175 (vs. gap) binding
- T207 (≠ C204) binding
- CAR 234:236 (≠ TAR 231:233) binding
- D260 (= D257) binding
- V261 (= V258) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVAW 283:286) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 84% coverage: 34:299/316 of query aligns to 28:285/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ G156), Y160 (vs. gap), D161 (vs. gap), P162 (vs. gap), I164 (= I173), L179 (≠ F190), T193 (≠ C204), P194 (= P205), S198 (≠ A209), L202 (= L213)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
35% identity, 87% coverage: 34:309/316 of query aligns to 35:313/332 of 6biiA
- active site: L99 (≠ A97), R240 (= R233), D264 (= D257), E269 (= E262), H287 (= H283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ T73), T103 (≠ V101), G156 (= G153), F157 (≠ R154), G158 (= G155), R159 (≠ G156), I160 (≠ L157), A179 (= A175), R180 (≠ E176), S181 (≠ H177), K183 (≠ G179), V211 (≠ C204), P212 (= P205), E216 (≠ A209), T217 (= T210), V238 (≠ T231), A239 (= A232), R240 (= R233), D264 (= D257), H287 (= H283), G289 (≠ A285)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 85% coverage: 31:299/316 of query aligns to 85:360/466 of P87228
- S87 (≠ A33) modified: Phosphoserine
- S258 (≠ T207) modified: Phosphoserine
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
30% identity, 91% coverage: 26:311/316 of query aligns to 39:339/346 of 4zgsA
- active site: S111 (≠ A97), R244 (= R233), D268 (= D257), E273 (= E262), H311 (= H283)
- binding nicotinamide-adenine-dinucleotide: Y110 (= Y96), G163 (= G155), A164 (≠ G156), I165 (≠ L157), D184 (≠ E176), C215 (= C204), P216 (= P205), L218 (≠ T207), S220 (≠ A209), T221 (= T210), S243 (≠ A232), H311 (= H283), F314 (≠ W286)
8atiA Human ctbp2(31-364) in complex with rai2 peptide(315-322)
36% identity, 77% coverage: 48:291/316 of query aligns to 49:297/330 of 8atiA
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T73), T102 (≠ V101), G155 (= G153), G157 (= G155), R158 (≠ G156), T159 (≠ L157), D178 (≠ E176), P179 (vs. gap), Y180 (vs. gap), H210 (= H203), C211 (= C204), N212 (≠ P205), A238 (≠ T231), R240 (= R233), H289 (= H283), A291 (= A285), W292 (= W286)
Sites not aligning to the query:
4lcjA Ctbp2 in complex with substrate mtob (see paper)
36% identity, 77% coverage: 48:291/316 of query aligns to 49:297/330 of 4lcjA
- active site: A98 (= A97), R240 (= R233), D264 (= D257), E269 (= E262), H289 (= H283)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: Y50 (≠ I49), H51 (≠ N50), I72 (≠ A71), G73 (≠ A72), S74 (≠ T73), G75 (= G74), R240 (= R233), H289 (= H283), W292 (= W286)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T73), T102 (≠ V101), I154 (= I152), G155 (= G153), G157 (= G155), R158 (≠ G156), T159 (≠ L157), D178 (≠ E176), Y180 (vs. gap), H210 (= H203), C211 (= C204), N212 (≠ P205), N214 (≠ T207), N217 (≠ T210), A238 (≠ T231), A239 (= A232), R240 (= R233), H289 (= H283), W292 (= W286)
Query Sequence
>WP_011764560.1 NCBI__GCF_000061505.1:WP_011764560.1
MTLSIVCLERDAVGAAFGRPRAPHRWTEFPSSAQEQVVERLRDAEVAIINKLRLGASEIA
ALPRLQMVAVAATGSDNVDLEACRARGIVVSNVRGYAVHTVPEHALMLMLALRRRLFDYV
ADVRAGRWARSDNFCFFDHPIGDLHGATLAIIGRGGLGDGVARLGAAFGMRVIYAEHKGV
AGVREGYTAFERVLAEADVLSLHCPLTPATRGLIGASELASMKREAVLVNTARGGVVDEP
ALAAALRAGVIAGAATDVLSSEPPREGNPLLAADIPNLIVTPHVAWASRQAMQTLADQVI
DNIDAFAAGAPRNRLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory