SitesBLAST
Comparing WP_011764768.1 NCBI__GCF_000061505.1:WP_011764768.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
63% identity, 99% coverage: 2:553/555 of query aligns to 4:539/539 of 6lpiB
- active site: I27 (= I25), G29 (= G27), G30 (= G28), S31 (≠ A29), I32 (= I30), E53 (= E51), C76 (≠ S74), F115 (= F113), Q116 (= Q114), E117 (= E115), K165 (= K163), M256 (= M256), A283 (= A283), V375 (= V384), G401 (= G410), M403 (= M412), D428 (= D437), N455 (= N464), A457 (≠ S466), L458 (= L467), L460 (= L469), V461 (= V470), Q464 (= Q473)
- binding flavin-adenine dinucleotide: R155 (= R153), G212 (= G210), G213 (= G211), G214 (= G212), T236 (= T236), L237 (= L237), M238 (= M238), L254 (= L254), M256 (= M256), H257 (= H257), G276 (= G276), A277 (= A277), R278 (= R278), D280 (= D280), R282 (= R282), A283 (= A283), D300 (= D300), I301 (≠ V301), D319 (= D319), V320 (= V320), M380 (= M389), G398 (= G407)
- binding magnesium ion: D428 (= D437), N455 (= N464)
- binding thiamine diphosphate: E53 (= E51), C76 (≠ S74), P79 (= P77), G376 (= G385), Q377 (= Q386), H378 (= H387), G401 (= G410), M403 (= M412), G427 (= G436), D428 (= D437), G429 (= G438), S430 (= S439), M433 (= M442), N455 (= N464), A457 (≠ S466), L458 (= L467), G459 (= G468), L460 (= L469), V461 (= V470)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 93:655/664 of P09114
- P191 (= P104) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ Q473) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
44% identity, 99% coverage: 6:553/555 of query aligns to 96:658/667 of P09342
- C161 (= C71) modified: Disulfide link with 307
- P194 (= P104) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V213) modified: Disulfide link with 161
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 13:575/582 of 3ea4A
- active site: Y32 (≠ I25), G34 (= G27), G35 (= G28), A36 (= A29), S37 (≠ I30), E58 (= E51), T81 (≠ S74), F120 (= F113), Q121 (= Q114), E122 (= E115), K170 (= K163), M265 (= M256), V292 (≠ A283), V399 (= V384), G425 (= G410), M427 (= M412), D452 (= D437), N479 (= N464), H481 (≠ S466), L482 (= L467), M484 (≠ L469), V485 (= V470), W488 (≠ Q473), H557 (≠ R535)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D281), R291 (= R282), W488 (≠ Q473), S567 (≠ P545)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R153), G221 (= G210), G222 (= G211), G223 (= G212), T245 (= T236), L246 (= L237), M247 (= M238), L263 (= L254), G264 (= G255), M265 (= M256), H266 (= H257), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (≠ V301), G327 (= G318), D328 (= D319), V329 (= V320), M404 (= M389), G422 (= G407)
- binding magnesium ion: D452 (= D437), N479 (= N464), H481 (≠ S466)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V384), G400 (= G385), Q401 (= Q386), H402 (= H387), M427 (= M412), G451 (= G436), D452 (= D437), G453 (= G438), S454 (= S439), N479 (= N464), H481 (≠ S466), L482 (= L467), G483 (= G468), M484 (≠ L469), V485 (= V470)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 13:575/582 of 3e9yA
- active site: Y32 (≠ I25), G34 (= G27), G35 (= G28), A36 (= A29), S37 (≠ I30), E58 (= E51), T81 (≠ S74), F120 (= F113), Q121 (= Q114), E122 (= E115), K170 (= K163), M265 (= M256), V292 (≠ A283), V399 (= V384), G425 (= G410), M427 (= M412), D452 (= D437), N479 (= N464), H481 (≠ S466), L482 (= L467), M484 (≠ L469), V485 (= V470), W488 (≠ Q473), H557 (≠ R535)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D281), R291 (= R282), W488 (≠ Q473), S567 (≠ P545)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R153), G221 (= G210), G222 (= G211), G223 (= G212), T245 (= T236), L246 (= L237), M247 (= M238), L263 (= L254), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (≠ V301), G327 (= G318), D328 (= D319), V329 (= V320), M404 (= M389), G422 (= G407)
- binding magnesium ion: D452 (= D437), N479 (= N464), H481 (≠ S466)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V384), G400 (= G385), Q401 (= Q386), H402 (= H387), M427 (= M412), G451 (= G436), G453 (= G438), S454 (= S439), N479 (= N464), H481 (≠ S466), L482 (= L467), G483 (= G468), M484 (≠ L469), V485 (= V470)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/585 of 5k2oA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M256), R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G286 (= G276), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), Q404 (= Q388), M405 (= M389), G423 (= G407)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), M428 (= M412), D453 (= D437), G454 (= G438), S455 (= S439), N480 (= N464), H482 (≠ S466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
44% identity, 99% coverage: 6:553/555 of query aligns to 99:661/670 of P17597
- A122 (= A29) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L31) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E51) binding
- S186 (= S93) binding
- P197 (= P104) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ P106) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q114) binding
- K220 (= K127) binding
- R246 (= R153) binding ; binding
- K256 (= K163) binding
- G308 (= G211) binding
- TL 331:332 (= TL 236:237) binding
- C340 (≠ V245) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 254:257) binding
- GVRFD 371:375 (≠ GARFD 276:280) binding
- DR 376:377 (= DR 281:282) binding
- DI 395:396 (≠ DV 300:301) binding
- DV 414:415 (= DV 319:320) binding
- QH 487:488 (= QH 386:387) binding
- GG 508:509 (= GG 407:408) binding
- GAM 511:513 (≠ GTM 410:412) binding
- D538 (= D437) binding
- DGS 538:540 (= DGS 437:439) binding
- N565 (= N464) binding
- NQHLGM 565:570 (≠ NNSLGL 464:469) binding
- H567 (≠ S466) binding
- W574 (≠ Q473) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P545) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/583 of 5k3sA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R282), M485 (≠ L469), W489 (≠ Q473), G569 (= G546)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), G286 (= G276), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), M405 (= M389), G423 (= G407)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), D453 (= D437), G454 (= G438), S455 (= S439), N480 (= N464), H482 (≠ S466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), G452 (= G436), D453 (= D437), G454 (= G438), S455 (= S439), M458 (= M442), N480 (= N464), H482 (≠ S466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), M405 (= M389), G423 (= G407)
- binding magnesium ion: F370 (≠ M354), D453 (= D437), M458 (= M442), Q461 (= Q445), N480 (= N464), H482 (≠ S466), K533 (≠ S510)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M256), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 5wj1A
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), M263 (= M253), L264 (= L254), G286 (= G276), R288 (= R278), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M256), D291 (= D281), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), M428 (= M412), D453 (= D437), G454 (= G438), S455 (= S439), M458 (= M442), N480 (= N464), H482 (≠ S466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 5k6tA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H257), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G286 (= G276), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), Q404 (= Q388), M405 (= M389), G423 (= G407)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), G452 (= G436), G454 (= G438), S455 (= S439), N480 (= N464), H482 (≠ S466), L483 (= L467), G484 (= G468)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 5k6rA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), G286 (= G276), R288 (= R278), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (≠ V301), G328 (= G318), D329 (= D319), V330 (= V320), M405 (= M389), G423 (= G407)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), D453 (= D437), G454 (= G438), S455 (= S439), M458 (= M442), N480 (= N464), H482 (≠ S466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 1z8nA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K127), R161 (= R153), Y191 (≠ P178), R194 (= R181), D291 (= D281), R292 (= R282), D312 (= D302), W489 (≠ Q473), G569 (= G546)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464)
- binding thiamine diphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), G452 (= G436), G454 (= G438), S455 (= S439), N480 (= N464), H482 (≠ S466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 1yi1A
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D281), R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), M263 (= M253), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 1yi0A
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (≠ V301), G328 (= G318), D329 (= D319), V330 (= V320), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 1yhzA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D281), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), Q404 (= Q388), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 1yhyA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), V486 (= V470), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), Q404 (= Q388), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 1ybhA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ I30), E59 (= E51), T82 (≠ S74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ S466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ R535)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M256), D291 (= D281), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), Q404 (= Q388), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ S466)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
44% identity, 99% coverage: 6:553/555 of query aligns to 14:576/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M256), R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), G452 (= G436), D453 (= D437), G454 (= G438), S455 (= S439), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), M263 (= M253), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), R288 (= R278), V293 (≠ A283), D310 (= D300), I311 (≠ V301), D329 (= D319), V330 (= V320), M405 (= M389), G423 (= G407)
- binding magnesium ion: A37 (= A29), T82 (≠ S74), S83 (= S75), Q122 (= Q114), Y381 (≠ G365), D453 (= D437), M458 (= M442), Q461 (= Q445), N480 (= N464), H482 (≠ S466), K533 (≠ S510)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
42% identity, 99% coverage: 4:553/555 of query aligns to 8:569/591 of 5wkcA
- active site: Y29 (≠ I25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (= I30), E55 (= E51), T78 (≠ S74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R222 (≠ A220), M258 (= M256), V285 (≠ A283), V401 (= V384), L426 (= L409), G427 (= G410), M429 (= M412), D454 (= D437), N481 (= N464), E483 (≠ S466), Q484 (≠ L467), M486 (≠ L469), V487 (= V470), W490 (≠ Q473), L512 (≠ I496), G517 (= G501), L518 (≠ I502), K551 (≠ R535)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V384), G402 (= G385), Q403 (= Q386), H404 (= H387), G427 (= G410), M429 (= M412), G453 (= G436), D454 (= D437), A455 (≠ G438), S456 (= S439), M459 (= M442), N481 (= N464), E483 (≠ S466), Q484 (≠ L467), G485 (= G468), M486 (≠ L469), V487 (= V470)
- binding ethaneperoxoic acid: G32 (= G28), Q118 (= Q114)
- binding flavin-adenine dinucleotide: R157 (= R153), G211 (= G210), A212 (≠ G211), G213 (= G212), N216 (vs. gap), T238 (= T236), L239 (= L237), Q240 (≠ M238), L256 (= L254), M258 (= M256), G278 (= G276), A279 (= A277), R280 (= R278), R284 (= R282), V285 (≠ A283), E311 (≠ D300), V312 (= V301), N316 (≠ E305), D330 (= D319), A331 (≠ V320), M406 (= M389), G424 (= G407)
- binding magnesium ion: D454 (= D437), N481 (= N464), E483 (≠ S466)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G28), A33 (= A29), V107 (= V103), F117 (= F113), K167 (= K163), M258 (= M256), R284 (= R282), M486 (≠ L469), W490 (≠ Q473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P26), E55 (= E51)
Query Sequence
>WP_011764768.1 NCBI__GCF_000061505.1:WP_011764768.1
MNQMTGAELIVRLLERQGVRTIAGIPGGAILPLYDALSQSDLIEHVLARHEQGAGFMAQG
MARVSGVPGVCFASSGPGATNLVTAIADAQLDSIPMVAITGQVPLPMIGTDAFQEVDIYG
MTVPITKHNFLVRSAEELLKVIPEAFRIAMSGRPGPVLVDVPKDVQNQRIEFAEFPPPAG
RDAVPALDAAAIDRAAAMINEAERPVLYLGGGVIHSGASAQAVTLAEQAGLPTTMTLMAL
GAMAVDHPLSIGMLGMHGARYTNYVLEEADLLVCVGARFDDRAIGRAAQFCPGARIVHID
VDPSELHKIKTAHVAIHGDVAAVLDALLPKVKVQLRKRWLSHVESLKSRFPMQMPDLDDP
RSHYGLIHAVAAALDDEAVIATDVGQHQMWVAQAYPFRRARQWLTSGGLGTMGFGMPTAI
GAALAAPERTVVCFSGDGSLQMNIQELATLAELGLNVKIVLMNNNSLGLVYQQQNLFYGK
RTFASKYRGGPDFCRIAEGYGIAAVDLDASDNPRATLAEALQAPGPCLIHASIDREQFVY
PMVPPGAANTEMIGG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory