Comparing WP_011765736.1 NCBI__GCF_000061505.1:WP_011765736.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
3tdtA Complex of tetrahydrodipicolinate n-succinyltransferase with 2-amino- 6-oxopimelate and coenzyme a (see paper)
72% identity, 99% coverage: 1:271/273 of query aligns to 1:271/274 of 3tdtA
2tdtA Complex of tetrahydrodipicolinate n-succinyltransferase with 2- aminopimelate and coenzyme a (see paper)
72% identity, 99% coverage: 1:271/273 of query aligns to 1:271/274 of 2tdtA
1kgtA Crystal structure of tetrahydrodipicolinate n-succinyltransferase in complex with pimelate and succinyl-coa (see paper)
72% identity, 99% coverage: 1:271/273 of query aligns to 1:271/274 of 1kgtA
1kgqA Crystal structure of tetrahydrodipicolinate n-succinyltransferase in complex with l-2-aminopimelate and succinamide-coa (see paper)
72% identity, 99% coverage: 1:271/273 of query aligns to 1:271/274 of 1kgqA
3r8yA Structure of the bacillus anthracis tetrahydropicolinate succinyltransferase
45% identity, 33% coverage: 104:194/273 of query aligns to 77:168/203 of 3r8yA
>WP_011765736.1 NCBI__GCF_000061505.1:WP_011765736.1
MQDLQKIIDDAFENRASLSPAAAPAAVRDAVAEVIAGLDAGTLRVAEKKDGQWVVNQWIK
KAVLISFRLRDNEVIPAGGLNFFDKVPTKFGDYTPEQFQQGGFRVVPPAVARKGSYIAKN
VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAGPVIIED
NVFVGARSEVVEGVIIEENAVLSMGVYIGQSTKIYDRETGSITYGRVPAGAVVVPGSLPS
ADGKYSLYCAVIVKKVDAQTRAKTGINELLRGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory