SitesBLAST
Comparing WP_011778298.1 NCBI__GCF_000015305.1:WP_011778298.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
50% identity, 95% coverage: 9:317/324 of query aligns to 6:312/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
50% identity, 95% coverage: 9:317/324 of query aligns to 4:310/311 of 3bazA
- active site: L98 (= L104), R230 (= R237), A251 (= A258), D254 (= D261), E259 (= E266), H277 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V80), G149 (= G156), L150 (= L157), G151 (= G158), R152 (= R159), I153 (= I160), S172 (≠ N179), R173 (= R180), S174 (≠ H181), C201 (≠ A208), P202 (≠ A209), T207 (= T214), I228 (= I235), G229 (≠ A236), R230 (= R237), D254 (= D261), H277 (= H284), G279 (≠ A286)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
47% identity, 95% coverage: 9:317/324 of query aligns to 6:310/319 of 5v6qB
- active site: L96 (= L104), R230 (= R237), D254 (= D261), E259 (= E266), H277 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V80), V100 (= V108), F148 (≠ I155), L150 (= L157), G151 (= G158), R152 (= R159), I153 (= I160), T172 (≠ N179), R173 (= R180), V201 (≠ A208), P202 (≠ A209), S206 (≠ G213), T207 (= T214), V228 (≠ I235), G229 (≠ A236), R230 (= R237), H277 (= H284), A279 (= A286)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
47% identity, 95% coverage: 9:317/324 of query aligns to 4:308/318 of 5j23A
- active site: L94 (= L104), R228 (= R237), D252 (= D261), E257 (= E266), H275 (= H284)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V80), L148 (= L157), G149 (= G158), R150 (= R159), I151 (= I160), T170 (≠ N179), R171 (= R180), P200 (≠ A209), S204 (≠ G213), T205 (= T214), R228 (= R237)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
47% identity, 95% coverage: 9:317/324 of query aligns to 5:309/319 of 5v7nA
- active site: L95 (= L104), R229 (= R237), D253 (= D261), E258 (= E266), H276 (= H284)
- binding 2-keto-D-gluconic acid: G70 (= G79), V71 (= V80), G72 (= G81), R229 (= R237), H276 (= H284), S279 (= S287), R285 (= R293)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V80), V99 (= V108), L149 (= L157), G150 (= G158), R151 (= R159), I152 (= I160), T171 (≠ N179), R172 (= R180), V200 (≠ A208), P201 (≠ A209), S205 (≠ G213), T206 (= T214), V227 (≠ I235), G228 (≠ A236), R229 (= R237), H276 (= H284), A278 (= A286)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
47% identity, 95% coverage: 9:317/324 of query aligns to 4:308/317 of 5v7gA
- active site: L94 (= L104), R228 (= R237), D252 (= D261), E257 (= E266), H275 (= H284)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V80), V98 (= V108), F146 (≠ I155), L148 (= L157), G149 (= G158), R150 (= R159), I151 (= I160), T170 (≠ N179), R171 (= R180), V199 (≠ A208), P200 (≠ A209), S204 (≠ G213), T205 (= T214), V226 (≠ I235), G227 (≠ A236), R228 (= R237), H275 (= H284), A277 (= A286)
- binding oxalate ion: G69 (= G79), V70 (= V80), G71 (= G81), R228 (= R237), H275 (= H284)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
41% identity, 82% coverage: 43:307/324 of query aligns to 39:311/334 of 5aovA
- active site: L100 (= L104), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H284)
- binding glyoxylic acid: M52 (≠ S56), L53 (≠ G57), L53 (≠ G57), Y74 (≠ F78), A75 (≠ G79), V76 (= V80), G77 (= G81), R241 (= R237), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V80), T104 (≠ V108), F158 (≠ L157), G159 (= G158), R160 (= R159), I161 (= I160), S180 (≠ N179), R181 (= R180), A211 (= A207), V212 (≠ A208), P213 (≠ A209), T218 (= T214), I239 (= I235), A240 (= A236), R241 (= R237), H288 (= H284), G290 (≠ A286)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
42% identity, 82% coverage: 43:307/324 of query aligns to 38:310/332 of 6biiA
- active site: L99 (= L104), R240 (= R237), D264 (= D261), E269 (= E266), H287 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V80), T103 (≠ V108), G156 (= G156), F157 (≠ L157), G158 (= G158), R159 (= R159), I160 (= I160), A179 (≠ N179), R180 (= R180), S181 (≠ H181), K183 (≠ V183), V211 (≠ A208), P212 (≠ A209), E216 (≠ G213), T217 (= T214), V238 (≠ I235), A239 (= A236), R240 (= R237), D264 (= D261), H287 (= H284), G289 (≠ A286)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
40% identity, 93% coverage: 7:307/324 of query aligns to 9:311/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
40% identity, 93% coverage: 7:307/324 of query aligns to 9:311/333 of 2dbqA
- active site: L100 (= L104), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V80), T104 (≠ V108), L158 (= L157), G159 (= G158), R160 (= R159), I161 (= I160), S180 (≠ N179), R181 (= R180), T182 (vs. gap), A211 (= A207), V212 (≠ A208), P213 (≠ A209), T218 (= T214), I239 (= I235), A240 (= A236), R241 (= R237), D265 (= D261), H288 (= H284), G290 (≠ A286)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
39% identity, 75% coverage: 61:304/324 of query aligns to 63:313/328 of Q9UBQ7
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
39% identity, 75% coverage: 61:304/324 of query aligns to 59:309/324 of 2gcgA
- active site: L103 (= L104), R241 (= R237), D265 (= D261), E270 (= E266), H289 (= H284)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G79), V79 (= V80), G80 (= G81), R241 (= R237), H289 (= H284)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V80), T107 (≠ V108), G156 (= G156), G158 (= G158), I160 (= I160), G180 (≠ N179), R181 (= R180), R184 (≠ V183), C212 (≠ A208), S213 (≠ A209), T218 (= T214), I239 (= I235), R241 (= R237), D265 (= D261), H289 (= H284), G291 (≠ A286)
Sites not aligning to the query:
4e5mA Thermostable phosphite dehydrogenase e175a/a176r in complex with NADP (see paper)
33% identity, 77% coverage: 61:309/324 of query aligns to 57:317/329 of 4e5mA
- active site: L100 (= L104), R237 (= R237), D261 (= D261), E266 (vs. gap), H292 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K76 (≠ V80), L100 (= L104), T104 (≠ V108), G154 (= G158), A155 (≠ R159), I156 (= I160), R176 (= R180), L208 (≠ A208), P209 (≠ A209), T214 (= T214), P235 (≠ I235), C236 (≠ A236), R237 (= R237), H292 (= H284), G294 (≠ A286)
4e5pA Thermostable phosphite dehydrogenase a176r variant in complex with nad (see paper)
33% identity, 77% coverage: 61:309/324 of query aligns to 57:317/332 of 4e5pA
- active site: L100 (= L104), R237 (= R237), D261 (= D261), E266 (vs. gap), H292 (= H284)
- binding nicotinamide-adenine-dinucleotide: K76 (≠ V80), L100 (= L104), T104 (≠ V108), G154 (= G158), A155 (≠ R159), I156 (= I160), A175 (≠ N179), R176 (= R180), L208 (≠ A208), P209 (≠ A209), T214 (= T214), P235 (≠ I235), C236 (≠ A236), R237 (= R237), H292 (= H284)
6ttbA Crystal structure of NAD-dependent formate dehydrogenase from staphylococcus aureus in complex with NAD
32% identity, 70% coverage: 42:267/324 of query aligns to 30:274/331 of 6ttbA
- binding nicotinamide-adenine-dinucleotide: V87 (= V80), N111 (≠ L104), V115 (= V108), F162 (≠ I155), G165 (= G158), R166 (= R159), I167 (= I160), Y185 (≠ H178), D186 (≠ N179), P187 (≠ R180), H214 (≠ A207), A215 (= A208), P216 (≠ A209), T221 (= T214), T242 (≠ I235), A243 (= A236), R244 (= R237)
Sites not aligning to the query:
4e5kA Thermostable phosphite dehydrogenase in complex with NAD and sulfite (see paper)
33% identity, 77% coverage: 61:309/324 of query aligns to 57:317/329 of 4e5kA
- active site: L100 (= L104), R237 (= R237), D261 (= D261), E266 (vs. gap), H292 (= H284)
- binding nicotinamide-adenine-dinucleotide: K76 (≠ V80), G77 (= G81), L100 (= L104), T104 (≠ V108), G152 (= G156), G154 (= G158), A155 (≠ R159), I156 (= I160), H174 (= H178), E175 (≠ N179), A176 (≠ R180), A207 (= A207), L208 (≠ A208), P209 (≠ A209), P235 (≠ I235), C236 (≠ A236), R237 (= R237), D261 (= D261), H292 (= H284), G294 (≠ A286)
- binding sulfite ion: L75 (≠ G79), K76 (≠ V80), G77 (= G81), L100 (= L104), R237 (= R237), H292 (= H284)
Sites not aligning to the query:
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
31% identity, 79% coverage: 43:297/324 of query aligns to 35:293/304 of 1wwkA
- active site: S96 (≠ L104), R230 (= R237), D254 (= D261), E259 (= E266), H278 (= H284)
- binding nicotinamide-adenine-dinucleotide: V100 (= V108), G146 (≠ K149), F147 (≠ T150), G148 (≠ N151), R149 (≠ V152), I150 (≠ G153), Y168 (≠ F171), D169 (≠ G172), P170 (≠ S176), V201 (≠ A208), P202 (≠ A209), T207 (= T214), T228 (≠ I235), S229 (≠ A236), D254 (= D261), H278 (= H284), G280 (≠ A286)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
34% identity, 88% coverage: 9:293/324 of query aligns to 5:287/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
34% identity, 88% coverage: 9:293/324 of query aligns to 4:286/526 of 3dc2A
Sites not aligning to the query:
2w2lA Crystal structure of the holo forms of rhodotorula graminis d- mandelate dehydrogenase at 2.5a.
31% identity, 79% coverage: 62:316/324 of query aligns to 70:337/346 of 2w2lA
- active site: G113 (≠ L104), R257 (= R237), D281 (= D261), E286 (= E266), H304 (= H284)
- binding nicotinamide-adenine-dinucleotide: T117 (≠ V108), G172 (= G158), A173 (≠ R159), I174 (= I160), D194 (≠ N179), V228 (≠ A208), P229 (≠ A209), T234 (= T214), T255 (≠ I235), A256 (= A236), R257 (= R237), H304 (= H284), G306 (≠ A286), G307 (≠ S287)
Query Sequence
>WP_011778298.1 NCBI__GCF_000015305.1:WP_011778298.1
MGTEENRSVLQVGPLMPSLSRRLADDYAARRLPTEPTERAAFLAERGAEIIAVVTSGRTG
VDAALMDALPNLAAVINFGVGYDTTDVAAAAARGIGVSNTPDVLTDCVADTAVGLMIDTL
RQFSASDRYVRAGRWPVDGMYPLTRQVSKTNVGIIGLGRIGAAIALRLKAFGCTISYHNR
HEVPDSPYTYAASPVELAASVDVLVVAAAGGDGTRGLVSSEVLDALGPHGYLINIARGSV
VDQDALVSALVERRLAGAGLDVFADEPQVPEELFALDTVVLLPHVASGTVQTRAAMEALT
LRNLDEFLATGELVTPVPLPAAAN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory