Comparing WP_011778808.1 NCBI__GCF_000015305.1:WP_011778808.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
79% identity, 97% coverage: 13:375/375 of query aligns to 4:366/368 of 7rytB
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
79% identity, 97% coverage: 13:375/375 of query aligns to 4:366/367 of 8f2lA
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
79% identity, 97% coverage: 11:373/375 of query aligns to 3:365/366 of 6puxA
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
81% identity, 97% coverage: 11:375/375 of query aligns to 3:367/375 of 6iohA
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
81% identity, 97% coverage: 11:373/375 of query aligns to 3:365/366 of 6ioiA
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
76% identity, 95% coverage: 19:374/375 of query aligns to 1:346/346 of 5w8oB
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
39% identity, 94% coverage: 18:370/375 of query aligns to 5:355/358 of P45131
Sites not aligning to the query:
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
37% identity, 94% coverage: 21:371/375 of query aligns to 12:346/347 of 2vatA
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
37% identity, 94% coverage: 21:371/375 of query aligns to 13:348/350 of 2vavB
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
36% identity, 97% coverage: 10:374/375 of query aligns to 2:374/374 of D2Z028
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
33% identity, 92% coverage: 26:370/375 of query aligns to 21:372/387 of Q6FEQ3
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 73% coverage: 26:297/375 of query aligns to 89:359/504 of Q10341
Sites not aligning to the query:
>WP_011778808.1 NCBI__GCF_000015305.1:WP_011778808.1
MTIVDLLTERVALPPEGEIAIVDIGPLTLENGEVIDDVSIAVQRWGELSARRDNVVVVLH
ALTGDSHITGPAGPDHPTPGWWDGVAGPGAPIDTDRWCAISTNVLGGCRGSTGPSSLAPD
GKAWGSRFPTISIRDQVAADVAALERFGITEVAAVIGGSMGGARALEWMMLHPDSVRAAL
VLAVGARATADQIGTQCTQVAAIKSDPNWRGGDYHGTGRSPDHGLEIARRFAHLTYRGET
ELDERFGNDAQPGEDPATGGRYSVQSYLEHQGRKLLARFDAGTYVTLTDALSSHDIGRGR
GGVAAALQSCPVPTVVGGITSDRLYPLRLQAELAELLPGCDGLDVVDSACGHDGFLVETD
AVGKLIRRTLELAAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory