Comparing WP_011779346.1 NCBI__GCF_000015305.1:WP_011779346.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3h0rH Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
45% identity, 83% coverage: 20:439/503 of query aligns to 2:410/410 of 3h0rH
3h0rE Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
45% identity, 83% coverage: 20:439/503 of query aligns to 2:410/410 of 3h0rE
3h0rB Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
45% identity, 83% coverage: 20:439/503 of query aligns to 2:410/410 of 3h0rB
3h0lB Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
45% identity, 83% coverage: 20:439/503 of query aligns to 2:410/410 of 3h0lB
3ip4B The high resolution structure of gatcab (see paper)
44% identity, 95% coverage: 21:498/503 of query aligns to 3:468/482 of 3ip4B
3al0B Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
41% identity, 94% coverage: 20:490/503 of query aligns to 2:467/482 of 3al0B
Sites not aligning to the query:
2g5iB Structure of tRNA-dependent amidotransferase gatcab complexed with adp-alf4 (see paper)
44% identity, 83% coverage: 21:439/503 of query aligns to 2:408/410 of 2g5iB
4wj3B Crystal structure of the asparagine transamidosome from pseudomonas aeruginosa (see paper)
44% identity, 81% coverage: 21:428/503 of query aligns to 1:397/456 of 4wj3B
Sites not aligning to the query:
2df4B Structure of tRNA-dependent amidotransferase gatcab complexed with mn2+ (see paper)
44% identity, 81% coverage: 21:429/503 of query aligns to 2:398/399 of 2df4B
3kfuF Crystal structure of the transamidosome (see paper)
45% identity, 82% coverage: 21:431/503 of query aligns to 2:389/447 of 3kfuF
Sites not aligning to the query:
2d6fD Crystal structure of glu-tRNA(gln) amidotransferase in the complex with tRNA(gln) (see paper)
26% identity, 50% coverage: 25:275/503 of query aligns to 10:260/522 of 2d6fD
Sites not aligning to the query:
>WP_011779346.1 NCBI__GCF_000015305.1:WP_011779346.1
MTSVTSDTAPLLDYDEVIAKYEPVLGLEVHVELSTATKMFCGCANRFGAEPNTQVCPVCL
GLPGSLPVLNQSAVEAAIRIGLALNCDIAPWGRFARKNYFYPDQPKNYQISQYDEPIAIN
GHLDVPLDDGTTWRVDIERAHMEEDTGKLTHLGSDTGRIAGATTSLADYNRSGVPLIEIV
TKPIEGTGERAPEIARAYVTALRDLLRALDVSDVRMDQGSMRCDSNVSLKPIGQAEFGTR
TETKNVNSLKSVEVAVRYEMRRQAAILESGATVHQETRHFHEDGHTSPGRSKETAQDYRY
FPEPDLEPVAPSAELVEQLRTTIPELPWLARKRIQQDWGISDEVMRDLVNIGALDLIAAT
VEHGASSDQARAWWGNFLVQKANESGVELEALPITPAQVAAVVKLVEDGKLSNKLARQVV
EGVLAGEGDPEQVMADRGLAVVRDDSLIQAAVDEALAANPDVVEKIRGGKVQAAGAIVGA
VMKATKGQADAARVRELVMAACS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory