SitesBLAST
Comparing WP_011779357.1 NCBI__GCF_000015305.1:WP_011779357.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
84% identity, 100% coverage: 3:528/528 of query aligns to 1:526/526 of 3dc2A
- active site: N96 (= N98), R230 (= R232), D254 (= D256), E259 (= E261), H277 (= H279)
- binding serine: Y458 (= Y460), D460 (= D462), R461 (≠ Q463), P462 (= P464), G463 (= G465), A464 (= A466), L465 (= L467), L484 (= L486)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
84% identity, 100% coverage: 2:528/528 of query aligns to 1:525/525 of 3ddnB
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
36% identity, 94% coverage: 2:498/528 of query aligns to 5:509/533 of O43175
- T78 (≠ V74) binding
- R135 (= R131) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 151:152) binding
- D175 (= D171) binding
- T207 (≠ L203) binding
- CAR 234:236 (≠ AAR 230:232) binding
- D260 (= D256) binding
- V261 (= V257) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (= HLGA 279:282) binding
- A373 (≠ S367) to T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- G377 (= G371) to S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- V425 (= V417) to M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- V490 (= V479) to M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
46% identity, 56% coverage: 2:296/528 of query aligns to 1:296/305 of 6plfA
7dkmA Phgdh covalently linked to oridonin (see paper)
46% identity, 56% coverage: 2:296/528 of query aligns to 1:296/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V74), A102 (= A102), G148 (= G148), R151 (= R151), I152 (= I152), Y170 (= Y170), D171 (= D171), P172 (= P172), I173 (≠ Y173), H202 (= H202), T203 (≠ L203), P204 (= P204), T209 (= T209), C230 (≠ A230), A231 (= A231), R232 (= R232), H279 (= H279), G281 (= G281)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ S15), K17 (≠ E18), I18 (≠ A19), E293 (≠ T293)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
46% identity, 55% coverage: 6:296/528 of query aligns to 4:295/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V147), G147 (= G148), L148 (= L149), G149 (= G150), R150 (= R151), I151 (= I152), G152 (= G153), D170 (= D171), H201 (= H202), T202 (≠ L203), P203 (= P204)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
46% identity, 55% coverage: 6:296/528 of query aligns to 4:295/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
46% identity, 55% coverage: 6:296/528 of query aligns to 4:295/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
46% identity, 55% coverage: 6:296/528 of query aligns to 4:295/301 of 6rj5A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
46% identity, 55% coverage: 6:296/528 of query aligns to 3:294/297 of 6rj3A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
46% identity, 55% coverage: 6:296/528 of query aligns to 1:292/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G150), I148 (= I152), Y166 (= Y170), D167 (= D171), P168 (= P172), I169 (≠ Y173), I170 (≠ V174), H198 (= H202), T199 (≠ L203), L208 (= L212), R228 (= R232)
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
46% identity, 55% coverage: 6:296/528 of query aligns to 3:294/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N98), A100 (= A102), R149 (= R151), I150 (= I152), Y168 (= Y170), D169 (= D171), P170 (= P172), I171 (≠ Y173), H200 (= H202), T201 (≠ L203), P202 (= P204), T207 (= T209), C228 (≠ A230), A229 (= A231), R230 (= R232), H277 (= H279), G279 (= G281)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
47% identity, 49% coverage: 37:296/528 of query aligns to 31:286/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (= R151), Y160 (= Y170), D161 (= D171), P162 (= P172), I164 (≠ V174), L179 (= L189), T193 (≠ L203), P194 (= P204), S198 (≠ E208), L202 (= L212)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
43% identity, 53% coverage: 34:313/528 of query aligns to 36:322/334 of 5aovA
- active site: L100 (≠ N98), R241 (= R232), D265 (= D256), E270 (= E261), H288 (= H279)
- binding glyoxylic acid: M52 (≠ R50), L53 (≠ S51), L53 (≠ S51), Y74 (≠ A72), A75 (≠ G73), V76 (= V74), G77 (= G75), R241 (= R232), H288 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V74), T104 (≠ A102), F158 (≠ L149), G159 (= G150), R160 (= R151), I161 (= I152), S180 (≠ D171), R181 (≠ P172), A211 (≠ H202), V212 (≠ L203), P213 (= P204), T218 (= T209), I239 (≠ A230), A240 (= A231), R241 (= R232), H288 (= H279), G290 (= G281)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
44% identity, 57% coverage: 6:305/528 of query aligns to 3:304/304 of 1wwkA
- active site: S96 (≠ N98), R230 (= R232), D254 (= D256), E259 (= E261), H278 (= H279)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ A102), G146 (= G148), F147 (≠ L149), G148 (= G150), R149 (= R151), I150 (= I152), Y168 (= Y170), D169 (= D171), P170 (= P172), V201 (≠ L203), P202 (= P204), T207 (= T209), T228 (≠ A230), S229 (≠ A231), D254 (= D256), H278 (= H279), G280 (= G281)
7cvpA The crystal structure of human phgdh from biortus.
41% identity, 51% coverage: 29:296/528 of query aligns to 5:249/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G148), G103 (= G150), R104 (= R151), I105 (= I152), Y123 (= Y170), D124 (= D171), P125 (= P172), I126 (≠ Y173), H155 (= H202), T156 (≠ L203), P157 (= P204), T162 (= T209), C183 (≠ A230), A184 (= A231), R185 (= R232), H232 (= H279), G234 (= G281)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
42% identity, 53% coverage: 34:313/528 of query aligns to 35:321/332 of 6biiA
- active site: L99 (≠ N98), R240 (= R232), D264 (= D256), E269 (= E261), H287 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V74), T103 (≠ A102), G156 (= G148), F157 (≠ L149), G158 (= G150), R159 (= R151), I160 (= I152), A179 (≠ S175), R180 (≠ H176), S181 (≠ A177), K183 (≠ A179), V211 (≠ L203), P212 (= P204), E216 (= E208), T217 (= T209), V238 (≠ A230), A239 (= A231), R240 (= R232), D264 (= D256), H287 (= H279), G289 (= G281)
6rj6A Crystal structure of phgdh in complex with bi-4924 (see paper)
46% identity, 37% coverage: 101:296/528 of query aligns to 5:200/204 of 6rj6A
- binding 2-[4-[(1~{S})-1-[[4,5-bis(chloranyl)-1,6-dimethyl-indol-2-yl]carbonylamino]-2-oxidanyl-ethyl]phenyl]sulfonylethanoic acid: G52 (= G148), R55 (= R151), I56 (= I152), Y74 (= Y170), D75 (= D171), P76 (= P172), I77 (≠ Y173), I78 (≠ V174), H106 (= H202), T107 (≠ L203), P108 (= P204), T113 (= T209)
7va1A Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35
47% identity, 37% coverage: 98:290/528 of query aligns to 1:193/193 of 7va1A
- binding 4-[(3-ethanoylphenyl)sulfamoyl]-~{N}-[4-(3-fluorophenyl)-1,3-thiazol-2-yl]benzamide: L50 (≠ V147), G53 (= G150), R57 (≠ Q154), Y73 (= Y170), D74 (= D171), P75 (= P172), I76 (≠ Y173), I77 (≠ V174), T106 (≠ L203), P107 (= P204), L115 (= L212)
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
47% identity, 37% coverage: 98:290/528 of query aligns to 3:195/195 of 5ofwA
- active site: N3 (= N98), R137 (= R232), D161 (= D256), E166 (= E261), H184 (= H279)
- binding 3-chloranyl-4-fluoranyl-benzamide: G53 (= G148), Y75 (= Y170), P77 (= P172), T108 (≠ L203), S113 (≠ E208), T114 (= T209), L117 (= L212)
Query Sequence
>WP_011779357.1 NCBI__GCF_000015305.1:WP_011779357.1
MSLPVVLIADKLAQSTVEALGDQVEVRWVDGPDREKLLAAVADADALLVRSATTVDAEVL
AAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAAARQIPAA
DATLREHSWKRSSFSGTEIFGKTVGVVGLGRIGQLVAQRLAAFGAHITAYDPYVSHARAA
QLGIELLTLDELLGRADFISVHLPKTKETAGLIGKEALAKTKPGVIIVNAARGGLIDEAA
LADAINSGHVRGAGLDVFSTEPCTDSPLFELPQVVVTPHLGASTVEAQDRAGTDVAASVK
LALAGEFVPDAVNVGGGAVGEEVAPWLDLVRKLGLLVGVLSSEPPVSLQVQVQGELASEE
VEVLKLSALRGLFSAVIEHPVTFVNAPALASERGVEASITTATESANHRSVVDVRAVAAD
GSTVNVAGTLTGPQLVEKIVQINGRNLELRAEGVNLIINYDDQPGALGKIGTLLGGAAVN
ILAAQLSQDADGIGATVMLRLDREVPGEVLAAIGRDVNAVTLEVVDLT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory