SitesBLAST
Comparing WP_011780137.1 NCBI__GCF_000015305.1:WP_011780137.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6hulB Sulfolobus solfataricus tryptophan synthase ab complex (see paper)
46% identity, 94% coverage: 17:425/433 of query aligns to 4:410/416 of 6hulB
- binding pyridoxal-5'-phosphate: H103 (= H115), K104 (= K116), Q131 (= Q143), S220 (= S233), G255 (= G269), G256 (= G270), G257 (= G271), S258 (= S272), N259 (= N273), E371 (= E389), S400 (= S415), G401 (= G416)
- binding serine: K104 (= K116), T127 (= T139), G128 (= G140), A129 (= A141), G130 (= G142), W132 (= W144)
4qysB Trpb2 enzymes (see paper)
42% identity, 97% coverage: 11:429/433 of query aligns to 5:416/418 of 4qysB
- active site: K101 (= K116), E123 (= E138), S402 (= S415)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: H100 (= H115), K101 (= K116), G252 (= G269), G253 (= G270), G254 (= G271), S255 (= S272), N256 (= N273), E373 (= E389), S402 (= S415)
4qysA Trpb2 enzymes (see paper)
39% identity, 97% coverage: 11:429/433 of query aligns to 5:406/408 of 4qysA
- active site: K108 (= K116), E130 (= E138), S392 (= S415)
- binding pyridoxal-5'-phosphate: H107 (= H115), K108 (= K116), G242 (= G269), G243 (= G270), G244 (= G271), S245 (= S272), N246 (= N273), E363 (= E389), S392 (= S415)
- binding phosphoserine: K108 (= K116), G132 (= G140), A133 (= A141), Q135 (= Q143), W136 (= W144), G316 (= G342), R318 (= R344), E363 (= E389)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
30% identity, 82% coverage: 69:422/433 of query aligns to 34:376/383 of 5vm5D
- active site: K82 (= K116), E104 (= E138), S369 (= S415)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H115), K82 (= K116), T105 (= T139), G106 (= G140), A107 (= A141), Q109 (= Q143), H110 (≠ W144), S185 (= S233), G227 (= G269), G229 (= G271), S230 (= S272), N231 (= N273), G296 (= G342), E343 (= E389), S369 (= S415)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
30% identity, 82% coverage: 69:422/433 of query aligns to 34:376/383 of 5t6mA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
30% identity, 82% coverage: 69:422/433 of query aligns to 34:376/394 of 5ixjD
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
30% identity, 82% coverage: 69:422/433 of query aligns to 34:378/386 of 5t6mB
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
30% identity, 82% coverage: 69:422/433 of query aligns to 34:378/388 of 5dw0A
- active site: K82 (= K116), E104 (= E138), S371 (= S415)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H115), K82 (= K116), T105 (= T139), G106 (= G140), A107 (= A141), Q109 (= Q143), H110 (≠ W144), S185 (= S233), G227 (= G269), G229 (= G271), S230 (= S272), N231 (= N273), G298 (= G342), D300 (≠ R344), E345 (= E389), S371 (= S415)
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
30% identity, 82% coverage: 69:422/433 of query aligns to 34:378/386 of 1v8zA
- active site: K82 (= K116), E104 (= E138), S371 (= S415)
- binding pyridoxal-5'-phosphate: H81 (= H115), K82 (= K116), Q109 (= Q143), S185 (= S233), G227 (= G269), G228 (= G270), G229 (= G271), S230 (= S272), N231 (= N273), E345 (= E389), S371 (= S415), G372 (= G416)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
30% identity, 82% coverage: 69:422/433 of query aligns to 34:378/384 of 7rnpA
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
30% identity, 82% coverage: 69:422/433 of query aligns to 34:378/385 of 6am8B
- active site: K82 (= K116), E104 (= E138), S371 (= S415)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H115), K82 (= K116), E104 (= E138), T105 (= T139), G106 (= G140), A107 (= A141), Q109 (= Q143), H110 (≠ W144), L161 (= L192), S185 (= S233), V187 (≠ L235), G227 (= G269), G228 (= G270), G229 (= G271), S230 (= S272), N231 (= N273), G298 (= G342), Y301 (= Y345), E345 (= E389), S371 (= S415), G372 (= G416)
- binding tryptophan: L169 (≠ V218), S274 (≠ D313), H275 (= H314)
Sites not aligning to the query:
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
31% identity, 82% coverage: 69:422/433 of query aligns to 34:378/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H115), K82 (= K116), T105 (= T139), G106 (= G140), A107 (= A141), Q109 (= Q143), H110 (≠ W144), S185 (= S233), G227 (= G269), G229 (= G271), S230 (= S272), N231 (= N273), G298 (= G342), E345 (= E389), S371 (= S415)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
31% identity, 82% coverage: 69:422/433 of query aligns to 34:377/383 of 5dw3A
- active site: K82 (= K116), E104 (= E138), S370 (= S415)
- binding tryptophan: K82 (= K116), E104 (= E138), T105 (= T139), G106 (= G140), A107 (= A141), Q109 (= Q143), H110 (≠ W144), S185 (= S233), G228 (= G270), Y300 (= Y345)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
31% identity, 82% coverage: 69:422/433 of query aligns to 34:378/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H115), K82 (= K116), T105 (= T139), G106 (= G140), A107 (= A141), Q109 (= Q143), H110 (≠ W144), S185 (= S233), G227 (= G269), G229 (= G271), S230 (= S272), N231 (= N273), G298 (= G342), E345 (= E389), S371 (= S415)
5ey5B Lbcats
30% identity, 80% coverage: 82:426/433 of query aligns to 49:382/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H115), K82 (= K116), Q109 (= Q143), S185 (= S233), G227 (= G269), G229 (= G271), S230 (= S272), N231 (= N273), E345 (= E389), S371 (= S415), G372 (= G416)
5kzmB Crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis (see paper)
30% identity, 83% coverage: 63:422/433 of query aligns to 36:383/395 of 5kzmB
6v82B Crystal structure of tryptophan synthase from chlamydia trachomatis d/uw-3/cx (see paper)
29% identity, 79% coverage: 82:423/433 of query aligns to 50:380/391 of 6v82B
6ducB Crystal structure of mutant beta-k167t tryptophan synthase in complex with inhibitor n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1- ethylphosphate (f9f) at the alpha-site, cesium ion at the metal coordination site, and 2-aminophenol quinonoid (1d0) at the beta-site
29% identity, 79% coverage: 82:422/433 of query aligns to 54:383/395 of 6ducB
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]-3-[(2-hydroxyphenyl)amino]propanoic acid: H85 (= H115), K86 (= K116), E108 (= E138), T109 (= T139), G110 (= G140), A111 (= A141), G112 (= G142), Q113 (= Q143), H114 (≠ W144), L165 (= L192), T189 (≠ S233), G231 (= G269), G232 (= G270), G233 (= G271), S234 (= S272), N235 (= N273), G302 (= G342), F305 (≠ Y345), E349 (= E389), S376 (= S415)
Sites not aligning to the query:
P0A879 Tryptophan synthase beta chain; EC 4.2.1.20 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 79% coverage: 82:422/433 of query aligns to 55:384/397 of P0A879
- C62 (≠ A89) active site, Nucleophile
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6xt0B Salmonella typhimurium tryptophan synthase complexed with dioxindolyl- l-alanine and d-glycerol-3-phosphate (see paper)
29% identity, 79% coverage: 82:422/433 of query aligns to 54:383/396 of 6xt0B
- active site: K86 (= K116), E108 (= E138), S376 (= S415)
- binding sodium ion: G231 (= G269), P269 (vs. gap), F305 (≠ Y345), S307 (≠ G347)
- binding 4-[(E)-({1-carboxy-2-[(3R)-3-hydroxy-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H115), K86 (= K116), E108 (= E138), T109 (= T139), G110 (= G140), Q113 (= Q143), H114 (≠ W144), L165 (= L192), G188 (= G232), T189 (≠ S233), G231 (= G269), G232 (= G270), G233 (= G271), S234 (= S272), N235 (= N273), G302 (= G342), F305 (≠ Y345), E349 (= E389), S376 (= S415)
- binding 4-[(E)-({1-carboxy-2-[(3R)-3-hydroxy-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H115), K86 (= K116), E108 (= E138), T109 (= T139), G110 (= G140), Q113 (= Q143), H114 (≠ W144), L165 (= L192), T189 (≠ S233), G231 (= G269), G232 (= G270), G233 (= G271), S234 (= S272), N235 (= N273), G302 (= G342), F305 (≠ Y345), E349 (= E389), S376 (= S415), G377 (= G416)
Query Sequence
>WP_011780137.1 NCBI__GCF_000015305.1:WP_011780137.1
MTEQLDATHPDLVTVKVPTHWYNLAAELDEPIPPHLHPGTREPVGPDDLAPLFASALIAQ
EVASETYIEIPQEVREIYAMWRPSPLIRARRFEKALNTGAHIYVKYEGVSPVGSHKTNSA
VAQAYYNHIDGVRKLTTETGAGQWGSALSFAGAQFGLEVEVWQVRASYESKPYRGHLIRT
YGGTVHSSPSTLTEAGRAILAKDPDTTGSLGMAVSEAVEVAAADPEARYALGSVLNHVVL
HQTVIGQEAVAQLALVEPDGADVVFGCAGGGSNLAGLSFPFLREKIHGRSNPRIVAAEPA
ACPSITRGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHAGGLRYHGMAPALSHTVELGL
VEGVAISQHDAFAAGVQFARTQGIVPAPESTHAIAAAAAHVADDPREQVVVIGLSGHGQL
DLPAYAEYLDGKF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory