SitesBLAST
Comparing WP_011782354.1 NCBI__GCF_000015305.1:WP_011782354.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6a50A Structure of benzoylformate decarboxylases in complex with cofactor tpp
30% identity, 96% coverage: 11:510/519 of query aligns to 12:520/527 of 6a50A
- binding magnesium ion: N117 (vs. gap), L118 (= L118), R120 (≠ H120), D428 (= D408), N455 (= N435), T457 (≠ A437)
- binding thiamine diphosphate: N23 (= N22), P24 (= P23), E47 (= E48), H70 (= H71), T377 (vs. gap), S378 (≠ N357), G401 (= G380), L403 (≠ I383), G427 (≠ A407), D428 (= D408), G429 (= G409), S430 (= S410), Y433 (= Y413), N455 (= N435), T457 (≠ A437), Y458 (= Y438), G459 (≠ D439), M460 (≠ I440), L461 (= L441)
5deiA Benzoylformate decarboxylase from pseudomonas putida
29% identity, 96% coverage: 11:510/519 of query aligns to 11:519/524 of 5deiA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (= L111), L109 (≠ E112), T110 (≠ S113), N111 (≠ D114), Y159 (≠ A158), P253 (≠ Y249), H280 (≠ F276), S375 (= S356), G400 (= G380), L402 (≠ I383), D427 (= D408), N454 (= N435), T456 (≠ A437), Y457 (= Y438), A459 (≠ I440), L460 (= L441), F463 (≠ E444)
- binding bicarbonate ion: S25 (≠ T25), H69 (= H71), L109 (≠ E112)
- binding calcium ion: N185 (≠ D181), D186 (= D182), D427 (= D408), N454 (= N435), T456 (≠ A437)
- binding magnesium ion: N116 (vs. gap), L117 (= L118), R119 (≠ H120)
- binding thiamine diphosphate: N22 (= N22), P23 (= P23), E46 (= E48), H69 (= H71), T376 (vs. gap), S377 (≠ N357), L402 (≠ I383), G426 (≠ A407), D427 (= D408), G428 (= G409), S429 (= S410), Y432 (= Y413), T456 (≠ A437), Y457 (= Y438), G458 (≠ D439), A459 (≠ I440), L460 (= L441)
Sites not aligning to the query:
3fsjX Crystal structure of benzoylformate decarboxylase in complex with the inhibitor mbp (see paper)
29% identity, 96% coverage: 11:510/519 of query aligns to 11:519/524 of 3fsjX
- active site: G24 (= G24), S25 (≠ T25), E27 (= E27), E46 (= E48), H69 (= H71), L108 (= L111), L109 (≠ E112), T110 (≠ S113), N111 (≠ D114), H280 (≠ F276), G400 (= G380), D427 (= D408), N454 (= N435), T456 (≠ A437), Y457 (= Y438), A459 (≠ I440), L460 (= L441)
- binding calcium ion: D427 (= D408), N454 (= N435), T456 (≠ A437)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: H280 (≠ F276), T376 (vs. gap), S377 (≠ N357), F396 (≠ L376), G400 (= G380), L402 (≠ I383), G426 (≠ A407), D427 (= D408), G428 (= G409), S429 (= S410), Y432 (= Y413), T456 (≠ A437), Y457 (= Y438), G458 (≠ D439), A459 (≠ I440), L460 (= L441), F463 (≠ E444)
Sites not aligning to the query:
1mczA Benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate (see paper)
29% identity, 96% coverage: 11:510/519 of query aligns to 11:519/524 of 1mczA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (= L111), L109 (≠ E112), T110 (≠ S113), N111 (≠ D114), Y159 (≠ A158), P253 (≠ Y249), H280 (≠ F276), S375 (= S356), G400 (= G380), L402 (≠ I383), D427 (= D408), N454 (= N435), T456 (≠ A437), Y457 (= Y438), A459 (≠ I440), L460 (= L441), F463 (≠ E444)
- binding magnesium ion: N116 (vs. gap), L117 (= L118), R119 (≠ H120), D427 (= D408), N454 (= N435), T456 (≠ A437)
- binding (r)-mandelic acid: S25 (≠ T25), H69 (= H71), L109 (≠ E112), H280 (≠ F276), T376 (vs. gap), F463 (≠ E444)
- binding thiamine diphosphate: N22 (= N22), P23 (= P23), E46 (= E48), H69 (= H71), T376 (vs. gap), S377 (≠ N357), G400 (= G380), L402 (≠ I383), G426 (≠ A407), D427 (= D408), G428 (= G409), S429 (= S410), Y432 (= Y413), Y457 (= Y438), G458 (≠ D439), A459 (≠ I440), L460 (= L441)
Sites not aligning to the query:
3f6bX Crystal structure of benzoylformate decarboxylase in complex with the pyridyl inhibitor paa (see paper)
29% identity, 96% coverage: 11:510/519 of query aligns to 11:519/525 of 3f6bX
- active site: G24 (= G24), E46 (= E48), L108 (= L111), L109 (≠ E112), T110 (≠ S113), N111 (≠ D114), G400 (= G380), D427 (= D408), N454 (= N435), T456 (≠ A437), Y457 (= Y438), A459 (≠ I440), L460 (= L441)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-2-[(1S,2E)-1-hydroxy-3-pyridin-3-ylprop-2-en-1-yl]-4-methyl-1,3-thiazol-3-ium: N22 (= N22), P23 (= P23), G24 (= G24), S25 (≠ T25), E46 (= E48), H69 (= H71)
Sites not aligning to the query:
3fznA Intermediate analogue in benzoylformate decarboxylase (see paper)
29% identity, 96% coverage: 11:510/519 of query aligns to 11:519/523 of 3fznA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (= L111), L109 (≠ E112), T110 (≠ S113), N111 (≠ D114), Y159 (≠ A158), P253 (≠ Y249), H280 (≠ F276), S375 (= S356), G400 (= G380), L402 (≠ I383), D427 (= D408), N454 (= N435), T456 (≠ A437), Y457 (= Y438), A459 (≠ I440), L460 (= L441), F463 (≠ E444)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: N22 (= N22), P23 (= P23), G24 (= G24), S25 (≠ T25), E46 (= E48), H69 (= H71), H280 (≠ F276), T376 (vs. gap), S377 (≠ N357), G400 (= G380), L402 (≠ I383), G426 (≠ A407), D427 (= D408), G428 (= G409), S429 (= S410), Y432 (= Y413), N454 (= N435), T456 (≠ A437), Y457 (= Y438), G458 (≠ D439), A459 (≠ I440)
- binding magnesium ion: D427 (= D408), N454 (= N435), T456 (≠ A437)
- binding phosphate ion: Q286 (vs. gap), L288 (vs. gap), K289 (≠ R281), P290 (= P282)
1bfdA Benzoylformate decarboxylase from pseudomonas putida (see paper)
29% identity, 96% coverage: 11:510/519 of query aligns to 11:519/523 of 1bfdA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (= L111), L109 (≠ E112), T110 (≠ S113), N111 (≠ D114), Y159 (≠ A158), P253 (≠ Y249), H280 (≠ F276), S375 (= S356), G400 (= G380), L402 (≠ I383), D427 (= D408), N454 (= N435), T456 (≠ A437), Y457 (= Y438), A459 (≠ I440), L460 (= L441), F463 (≠ E444)
- binding calcium ion: D427 (= D408), N454 (= N435), T456 (≠ A437)
- binding magnesium ion: N116 (vs. gap), L117 (= L118), R119 (≠ H120)
- binding thiamine diphosphate: T376 (vs. gap), S377 (≠ N357), L402 (≠ I383), G426 (≠ A407), D427 (= D408), G428 (= G409), S429 (= S410), Y432 (= Y413), T456 (≠ A437), Y457 (= Y438), G458 (≠ D439), A459 (≠ I440), L460 (= L441)
1pi3A E28q mutant benzoylformate decarboxylase from pseudomonas putida
29% identity, 96% coverage: 11:510/519 of query aligns to 11:519/523 of 1pi3A
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), Q27 (≠ E27), E46 (= E48), H69 (= H71), L108 (= L111), L109 (≠ E112), T110 (≠ S113), N111 (≠ D114), Y159 (≠ A158), P253 (≠ Y249), H280 (≠ F276), S375 (= S356), G400 (= G380), L402 (≠ I383), D427 (= D408), N454 (= N435), T456 (≠ A437), Y457 (= Y438), A459 (≠ I440), L460 (= L441), F463 (≠ E444)
- binding calcium ion: D427 (= D408), N454 (= N435), T456 (≠ A437)
- binding magnesium ion: N116 (vs. gap), L117 (= L118), R119 (≠ H120)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: T376 (vs. gap), S377 (≠ N357), L402 (≠ I383), G426 (≠ A407), G428 (= G409), S429 (= S410), Y432 (= Y413), N454 (= N435), T456 (≠ A437), Y457 (= Y438), G458 (≠ D439), A459 (≠ I440), L460 (= L441)
7orxCCC jostii RHA1 thiamine diphosphate-dependent 4-hydroxybenzoylformate decarboxylase
29% identity, 96% coverage: 14:510/519 of query aligns to 18:523/531 of 7orxCCC
- active site: N26 (= N22), G28 (= G24), S29 (≠ T25), N30 (≠ S26), E31 (= E27), E50 (= E48), H73 (= H71), M112 (≠ P110), L113 (= L111), S114 (= S113), N115 (≠ D114), Y163 (≠ A158), P257 (≠ Y249), H284 (≠ F276), S379 (= S356), G404 (= G381), L406 (≠ I383), D431 (= D408), N458 (= N435), T460 (≠ A437), Y461 (= Y438), A463 (≠ I440), L464 (= L441), F467 (≠ L445)
- binding thiamine diphosphate: N26 (= N22), S29 (≠ T25), E50 (= E48), H73 (= H71), T380 (≠ N357), S381 (≠ T358), G404 (= G381), L406 (≠ I383), G430 (≠ A407), G432 (= G409), S433 (= S410), Y436 (= Y413), N458 (= N435), T460 (≠ A437), Y461 (= Y438), G462 (≠ D439)
6qsiA Pseudomonas fluorescens pf-5 thiamine diphosphate-dependent 4- hydroxybenzoylformate decarboxylase (see paper)
29% identity, 97% coverage: 11:516/519 of query aligns to 11:523/525 of 6qsiA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), M108 (≠ P110), L109 (= L111), A110 (≠ S113), Y159 (≠ A158), P253 (≠ Y249), H280 (≠ F276), S375 (= S356), G400 (= G380), L402 (≠ I383), Y457 (= Y438), A459 (≠ I440), L460 (= L441), F463 (≠ E444)
- binding thiamine diphosphate: N22 (= N22), P23 (= P23), E46 (= E48), H69 (= H71), T376 (vs. gap), S377 (≠ N357), L402 (≠ I383), G426 (≠ A407), G428 (= G409), S429 (= S410), Y432 (= Y413), N454 (= N435), T456 (≠ A437), Y457 (= Y438), G458 (≠ D439), A459 (≠ I440), L460 (= L441)
4q9dB X-ray structure of a putative thiamin diphosphate-dependent enzyme isolated from mycobacterium smegmatis (see paper)
26% identity, 97% coverage: 15:516/519 of query aligns to 17:518/519 of 4q9dB
- active site: N24 (= N22), G26 (= G24), S27 (≠ T25), T28 (≠ S26), E29 (= E27), Q47 (≠ F47), E48 (= E48), H71 (= H71), V107 (≠ Y107), D108 (= D108), Y110 (≠ P110), L111 (= L111), N112 (≠ E112), N113 (≠ S113), L161 (≠ A158), P252 (≠ A248), Y279 (= Y278), M374 (≠ D354), S376 (= S356), G401 (= G381), I403 (= I383), D432 (= D408), N459 (= N435), E461 (≠ A437), Y462 (= Y438), I464 (= I440)
- binding magnesium ion: D432 (= D408), N459 (= N435), E461 (≠ A437)
Sites not aligning to the query:
4k9qA The crystal structure of benzoylformate decarboxylase from polynucleobacter necessarius
25% identity, 96% coverage: 16:514/519 of query aligns to 17:523/531 of 4k9qA
- active site: N23 (= N22), G25 (= G24), S26 (≠ T25), T27 (≠ S26), E28 (= E27), E47 (= E48), H70 (= H71), N106 (≠ D108), E107 (≠ A109), L110 (≠ E112), T111 (≠ S113), L160 (≠ A158), T251 (≠ Y249), Y278 (= Y278), V370 (= V353), C373 (≠ S356), G398 (= G381), L400 (≠ I383), D429 (= D408), N456 (= N435), E458 (≠ A437), Y459 (= Y438), G460 (≠ D439), I461 (= I440), L462 (= L441), F465 (≠ G449)
- binding magnesium ion: D429 (= D408), N456 (= N435), E458 (≠ A437)
- binding thiamine diphosphate: P374 (≠ N357), S375 (≠ T358), L400 (≠ I383), G428 (≠ A407), D429 (= D408), G430 (= G409), S431 (= S410), Y434 (= Y413), N456 (= N435), E458 (≠ A437), Y459 (= Y438), G460 (≠ D439), I461 (= I440), L462 (= L441)
Sites not aligning to the query:
6lpiB Crystal structure of ahas holo-enzyme (see paper)
26% identity, 99% coverage: 1:513/519 of query aligns to 6:519/539 of 6lpiB
- active site: I27 (≠ N22), G29 (= G24), G30 (≠ T25), S31 (= S26), I32 (≠ E27), E53 (= E48), C76 (≠ H71), F115 (≠ P110), Q116 (≠ L111), E117 (= E112), K165 (≠ A158), M256 (≠ V241), A283 (≠ F275), V375 (≠ S356), G401 (= G381), M403 (≠ I383), D428 (= D408), N455 (= N435), A457 (= A437), L458 (≠ Y438), L460 (≠ I440), V461 (≠ L441), Q464 (≠ E444)
- binding flavin-adenine dinucleotide: R155 (= R147), G212 (= G203), G213 (= G204), G214 (≠ D205), T236 (vs. gap), L237 (vs. gap), M238 (≠ T222), L254 (≠ A239), M256 (≠ V241), H257 (≠ P242), G276 (= G268), A277 (= A269), R278 (≠ A270), D280 (≠ P272), R282 (≠ S274), A283 (≠ F275), D300 (vs. gap), I301 (vs. gap), D319 (≠ L308), V320 (≠ A309), M380 (≠ V361), G398 (≠ T379)
- binding magnesium ion: D428 (= D408), N455 (= N435)
- binding thiamine diphosphate: E53 (= E48), C76 (≠ H71), P79 (= P74), G376 (≠ N357), Q377 (≠ T358), H378 (≠ A359), G401 (= G381), M403 (≠ I383), G427 (≠ A407), D428 (= D408), G429 (= G409), S430 (= S410), M433 (≠ Y413), N455 (= N435), A457 (= A437), L458 (≠ Y438), G459 (≠ D439), L460 (≠ I440), V461 (≠ L441)
1y9dD Pyruvate oxidase variant v265a from lactobacillus plantarum (see paper)
24% identity, 98% coverage: 6:513/519 of query aligns to 8:511/560 of 1y9dD
- active site: I24 (≠ N22), G26 (= G24), G27 (≠ T25), S28 (= S26), I29 (≠ E27), E51 (= E48), S74 (≠ H71), E108 (≠ K105), V155 (≠ A158), R241 (= R237), V361 (≠ S356), A387 (= A382), M389 (≠ I383), D414 (= D408), N441 (= N435), Q443 (≠ A437), Y444 (= Y438), F446 (≠ I440), I447 (≠ L441), E450 (= E444)
- binding flavin-adenine dinucleotide: I198 (≠ G204), G199 (≠ D205), T221 (≠ E220), P223 (≠ T222), G261 (≠ A267), N262 (≠ G268), N263 (≠ A269), D273 (≠ P279), I274 (≠ G280), K278 (≠ D284), D292 (vs. gap), A293 (≠ G297)
- binding magnesium ion: D414 (= D408), N441 (= N435), Q443 (≠ A437)
- binding thiamine diphosphate: E51 (= E48), S74 (≠ H71), P77 (= P74), H81 (≠ N78), D363 (≠ T358), M389 (≠ I383), G413 (≠ A407), G415 (= G409), N441 (= N435), Q443 (≠ A437), Y444 (= Y438), G445 (≠ D439), F446 (≠ I440), I447 (≠ L441)
Sites not aligning to the query:
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
36% identity, 26% coverage: 381:514/519 of query aligns to 505:636/664 of P09114
- W568 (≠ I443) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
Sites not aligning to the query:
- 191 P→A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
36% identity, 26% coverage: 381:514/519 of query aligns to 508:639/667 of P09342
Sites not aligning to the query:
- 161 modified: Disulfide link with 307
- 194 P→Q: In C3; highly resistant to sulfonylurea herbicides.
- 307 modified: Disulfide link with 161
1upaA Carboxyethylarginine synthase from streptomyces clavuligerus (semet structure) (see paper)
35% identity, 32% coverage: 348:513/519 of query aligns to 389:545/558 of 1upaA
- active site: I396 (≠ E355), S422 (≠ G381), F424 (≠ I383), D449 (= D408), N476 (= N435), T478 (≠ A437), N479 (≠ Y438), L481 (≠ I440), I482 (≠ L441), Y485 (≠ L445)
- binding magnesium ion: D449 (= D408), N476 (= N435), T478 (≠ A437)
- binding sulfate ion: R400 (≠ A359), H401 (≠ G360), N476 (= N435)
- binding thiamine diphosphate: I396 (≠ E355), G397 (≠ S356), F398 (≠ N357), F399 (≠ T358), F424 (≠ I383), G448 (≠ A407), D449 (= D408), G450 (= G409), T478 (≠ A437), N479 (≠ Y438), G480 (≠ D439)
Sites not aligning to the query:
- active site: 22, 24, 25, 26, 27, 46, 69, 109, 110, 111, 159, 261, 288, 547
- binding sulfate ion: 257, 546, 547, 548
- binding thiamine diphosphate: 46, 69, 547
2ihuC Carboxyethylarginine synthase from streptomyces clavuligerus: putative reaction intermediate complex (see paper)
35% identity, 32% coverage: 348:513/519 of query aligns to 393:549/551 of 2ihuC
- active site: I400 (≠ E355), S426 (≠ G381), F428 (≠ I383), D453 (= D408), N480 (= N435), T482 (≠ A437), N483 (≠ Y438), L485 (≠ I440), I486 (≠ L441), Y489 (≠ L445)
- binding magnesium ion: D453 (= D408), N480 (= N435), T482 (≠ A437)
- binding 5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-2-[(1z)-1-hydroxy-3-(phosphonooxy)prop-1-en-1-yl]-3-{[(4z)-4-imino-2-methyl-4,5-dihydropyrimidin-5-yl]methyl}-4-methyl-1,3-thiazol-3-ium: G401 (≠ S356), F402 (≠ N357), F403 (≠ T358), F428 (≠ I383), G452 (≠ A407), D453 (= D408), G454 (= G409), T482 (≠ A437), N483 (≠ Y438), G484 (≠ D439), L485 (≠ I440), I486 (≠ L441), Y489 (≠ L445)
Sites not aligning to the query:
- active site: 23, 25, 26, 27, 28, 47, 70, 110, 111, 112, 160, 265, 292, 551
- binding 5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-2-[(1z)-1-hydroxy-3-(phosphonooxy)prop-1-en-1-yl]-3-{[(4z)-4-imino-2-methyl-4,5-dihydropyrimidin-5-yl]methyl}-4-methyl-1,3-thiazol-3-ium: 551
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: 23, 47, 70, 73
2ihuA Carboxyethylarginine synthase from streptomyces clavuligerus: putative reaction intermediate complex (see paper)
35% identity, 32% coverage: 348:513/519 of query aligns to 393:549/562 of 2ihuA
- active site: I400 (≠ E355), S426 (≠ G381), F428 (≠ I383), D453 (= D408), N480 (= N435), T482 (≠ A437), N483 (≠ Y438), L485 (≠ I440), I486 (≠ L441), Y489 (≠ L445)
- binding magnesium ion: D453 (= D408), N480 (= N435), T482 (≠ A437)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: G401 (≠ S356), F402 (≠ N357), F403 (≠ T358), F428 (≠ I383), G452 (≠ A407), D453 (= D408), G454 (= G409), G455 (≠ S410), T482 (≠ A437), N483 (≠ Y438), G484 (≠ D439), L485 (≠ I440), I486 (≠ L441)
Sites not aligning to the query:
- active site: 23, 25, 26, 27, 28, 47, 70, 110, 111, 112, 160, 265, 292, 551
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: 47, 70, 73, 551
Q9LCV9 N(2)-(2-carboxyethyl)arginine synthase; CEA synthetase; CEAS; EC 2.5.1.66 from Streptomyces clavuligerus (see 2 papers)
35% identity, 32% coverage: 348:513/519 of query aligns to 403:559/573 of Q9LCV9
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 271 binding
- 301 binding
- 561 binding
- 571 binding
Query Sequence
>WP_011782354.1 NCBI__GCF_000015305.1:WP_011782354.1
MNGARSLLTTLVDQGVDVCFANPGTSEMHFVAALDTVPGMRGVLTLFEGVATGAADGYAR
MSGKPAAVLLHLGPGLGNGLANLHNARRAHVPMVVVVGDHATYHKKYDAPLESDIDALAH
TVSGWVRRTLDVGDIAVDAVDAVAASRAGVVSTMIVPADVSWNDGEPTEPLPAGHPAPGI
DDDAVREAADALNSGVPTVLLVGGDATLAPGLSAAVRIAERTGAKVLCETFPARLQRGAG
VPAVERLAYFAEGAEAQLVGAEHLILAGAASPVSFFAYPGRPSDLVPQGCEVHVLAGHSG
AAAALEQLADDVAPGTTASVAPLMRPDLPTGELTAFSAAAVIGALLPEGAVVVDESNTAG
VGVAAATAGAPGHDVLTLTGGAIGYGMPAAIGAAMAAPDRPVLSLQADGSAMYTVSALWT
QARENLDVTTVIFGNGAYDILRIELQRVGAENAATPGPSALRLLDLGSPTLDFVKIAEGM
GVPARRVSTAEDLAAALTEAFAAPGPHLIEAVVPSLVNT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory