SitesBLAST
Comparing WP_011801377.1 NCBI__GCF_000015505.1:WP_011801377.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A799 Phosphoglycerate kinase; EC 2.7.2.3 from Escherichia coli (strain K12) (see 3 papers)
59% identity, 99% coverage: 1:396/400 of query aligns to 1:386/387 of P0A799
- M1 (= M1) modified: Initiator methionine, Removed
- K84 (≠ L89) modified: N6-acetyllysine
1zmrA Crystal structure of the e. Coli phosphoglycerate kinase (see paper)
59% identity, 99% coverage: 2:396/400 of query aligns to 1:385/386 of 1zmrA
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
54% identity, 95% coverage: 17:395/400 of query aligns to 13:390/392 of 4feyA
- active site: R36 (= R41), K193 (= K198), G346 (= G351), G369 (= G374)
- binding adenosine-5'-diphosphate: G191 (= G196), S192 (= S197), K197 (= K202), G215 (= G220), G316 (= G321), V317 (= V322), E319 (= E324), D347 (= D352)
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
54% identity, 95% coverage: 17:396/400 of query aligns to 12:389/389 of 4ng4B
- active site: R35 (= R41), K191 (= K198), G344 (= G351), G367 (= G374)
- binding adenosine-5'-diphosphate: G189 (= G196), K195 (= K202), G213 (= G220), I286 (= I293), N310 (= N317), G311 (= G318), P312 (= P319), V315 (= V322), E317 (= E324), G343 (= G350), D345 (= D352), T346 (= T353)
- binding magnesium ion: D288 (= D295), G314 (= G321), F321 (= F328), S322 (= S329), T325 (= T332)
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
43% identity, 97% coverage: 1:386/400 of query aligns to 1:386/394 of P40924
- S183 (≠ A184) modified: Phosphoserine
- T299 (= T300) modified: Phosphothreonine
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
44% identity, 98% coverage: 1:393/400 of query aligns to 1:393/394 of 1phpA
- active site: R36 (= R41), K197 (= K198), G351 (= G351), G374 (= G374)
- binding adenosine-5'-diphosphate: G195 (= G196), K201 (= K202), G219 (= G220), G220 (= G221), L237 (= L238), N316 (= N317), P318 (= P319), G320 (= G321), V321 (= V322), E323 (= E324), G350 (= G350), D352 (= D352), S353 (≠ T353)
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
44% identity, 98% coverage: 1:393/400 of query aligns to 1:393/394 of P18912
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
44% identity, 92% coverage: 18:386/400 of query aligns to 14:389/654 of P36204
- R36 (= R41) binding
- R118 (= R118) binding
- R151 (= R151) binding
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
44% identity, 92% coverage: 18:386/400 of query aligns to 13:388/398 of 1vpeA
- active site: R35 (= R41), K196 (= K198), G353 (= G351), G376 (= G374)
- binding phosphoaminophosphonic acid-adenylate ester: G194 (= G196), A195 (≠ S197), K196 (= K198), K200 (= K202), G218 (= G220), A219 (≠ G221), N316 (= N317), P318 (= P319), G320 (= G321), V321 (= V322), E323 (= E324), G352 (= G350), G353 (= G351), D354 (= D352), S355 (≠ T353)
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
41% identity, 94% coverage: 18:391/400 of query aligns to 13:412/415 of 16pkA
- active site: R35 (= R41), K215 (= K198), G372 (= G351), G395 (= G374)
- binding 1,1,5,5-tetrafluorophosphopentylphosphonic acid adenylate ester: G213 (= G196), A214 (≠ S197), K219 (= K202), A238 (≠ G221), Y241 (≠ N224), L311 (= L294), P336 (= P319), G338 (= G321), V339 (= V322), E341 (= E324), G393 (= G372), G394 (= G373), G395 (= G374)
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
41% identity, 94% coverage: 18:391/400 of query aligns to 13:412/415 of 13pkA
- active site: R35 (= R41), K215 (= K198), G372 (= G351), G395 (= G374)
- binding adenosine-5'-diphosphate: G213 (= G196), A214 (≠ S197), K219 (= K202), L311 (= L294), P336 (= P319), G338 (= G321), V339 (= V322), E341 (= E324), G371 (= G350), D373 (= D352), S374 (≠ T353)
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
40% identity, 96% coverage: 18:400/400 of query aligns to 17:425/440 of P07378
P00560 Phosphoglycerate kinase; EC 2.7.2.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
40% identity, 94% coverage: 17:393/400 of query aligns to 16:414/416 of P00560
- R22 (= R23) mutation to K: 2-fold reduction of Vmax.; mutation to M: 7-fold reduction of Vmax.
- R39 (= R41) binding
- R122 (= R118) binding
- R169 (= R151) binding
1qpgA 3-phosphoglycerate kinase, mutation r65q (see paper)
40% identity, 94% coverage: 17:393/400 of query aligns to 15:413/415 of 1qpgA
- active site: R38 (= R41), K213 (= K198), G371 (= G351), G394 (= G374)
- binding magnesium-5'-adenyly-imido-triphosphate: G235 (= G220), G236 (= G221), N334 (= N317), P336 (= P319), G338 (= G321), V339 (= V322), F340 (= F323), E341 (= E324), G370 (= G350), G371 (= G351), D372 (= D352), T373 (= T353)
3zlbA Crystal structure of phosphoglycerate kinase from streptococcus pneumoniae (see paper)
42% identity, 94% coverage: 18:394/400 of query aligns to 14:398/398 of 3zlbA
- active site: R36 (= R41), K204 (= K198), G355 (= G351), G378 (= G374)
- binding phosphoaminophosphonic acid-adenylate ester: G202 (= G196), S203 (= S197), G226 (= G220), G227 (= G221), N320 (= N317), P322 (= P319), G324 (= G321), V325 (= V322), E327 (= E324), G354 (= G350), G355 (= G351), D356 (= D352), S357 (≠ T353)
- binding magnesium ion: K398 (≠ H394)
Sites not aligning to the query:
3pgkA The structure of yeast phosphoglycerate kinase at 0.25 nm resolution (see paper)
40% identity, 94% coverage: 17:393/400 of query aligns to 15:413/415 of 3pgkA
- active site: R38 (= R41), K213 (= K198), G371 (= G351), G394 (= G374)
- binding adenosine-5'-triphosphate: G211 (= G196), A212 (≠ S197), K213 (= K198), F289 (= F273), L311 (= L294), N334 (= N317), G335 (= G318), P336 (= P319), G338 (= G321), V339 (= V322), D372 (= D352)
O60101 Phosphoglycerate kinase; EC 2.7.2.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
40% identity, 92% coverage: 18:386/400 of query aligns to 17:406/414 of O60101
- Y75 (≠ D77) modified: Phosphotyrosine
- S76 (= S78) modified: Phosphoserine
- S143 (= S125) modified: Phosphoserine
- S172 (≠ A154) modified: Phosphoserine
- S173 (≠ T155) modified: Phosphoserine
- S183 (≠ A168) modified: Phosphoserine
- S253 (= S237) modified: Phosphoserine
- S260 (≠ V244) modified: Phosphoserine
- T299 (≠ K282) modified: Phosphothreonine
- S328 (≠ A311) modified: Phosphoserine
- S351 (≠ G334) modified: Phosphoserine
- T373 (= T353) modified: Phosphothreonine
- S387 (≠ G367) modified: Phosphoserine
- S390 (= S370) modified: Phosphoserine
Sites not aligning to the query:
- 412 modified: Phosphoserine
- 413 modified: Phosphoserine
2wzcA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and aluminium tetrafluoride (see paper)
38% identity, 94% coverage: 18:393/400 of query aligns to 15:404/405 of 2wzcA
- active site: R37 (= R41), K204 (= K198), G362 (= G351), G385 (= G374)
- binding adenosine-5'-diphosphate: G202 (= G196), A203 (≠ S197), K204 (= K198), K208 (= K202), G226 (= G220), G227 (= G221), N325 (= N317), P327 (= P319), G329 (= G321), V330 (= V322), E332 (= E324), G361 (= G350), D363 (= D352), T364 (= T353)
- binding tetrafluoroaluminate ion: R37 (= R41), K204 (= K198), K208 (= K202), G361 (= G350), G362 (= G351), G384 (= G373)
2wzbA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and magnesium trifluoride (see paper)
38% identity, 94% coverage: 18:393/400 of query aligns to 15:404/405 of 2wzbA
- active site: R37 (= R41), K204 (= K198), G362 (= G351), G385 (= G374)
- binding adenosine-5'-diphosphate: G202 (= G196), A203 (≠ S197), K204 (= K198), K208 (= K202), G226 (= G220), G227 (= G221), N325 (= N317), P327 (= P319), G329 (= G321), V330 (= V322), E332 (= E324), G361 (= G350), D363 (= D352), T364 (= T353)
- binding trifluoromagnesate: K204 (= K198), K208 (= K202), G361 (= G350), G384 (= G373), G385 (= G374)
2wzdA The catalytically active fully closed conformation of human phosphoglycerate kinase k219a mutant in complex with adp, 3pg and aluminium trifluoride (see paper)
38% identity, 94% coverage: 18:393/400 of query aligns to 15:404/405 of 2wzdA
- active site: R37 (= R41), K204 (= K198), G362 (= G351), G385 (= G374)
- binding adenosine-5'-diphosphate: G202 (= G196), A203 (≠ S197), K204 (= K198), G226 (= G220), G227 (= G221), N325 (= N317), P327 (= P319), G329 (= G321), V330 (= V322), E332 (= E324), G361 (= G350), D363 (= D352), T364 (= T353)
- binding aluminum fluoride: R37 (= R41), K204 (= K198), G361 (= G350), G362 (= G351), G384 (= G373)
Query Sequence
>WP_011801377.1 NCBI__GCF_000015505.1:WP_011801377.1
MNVLRFSDVIQSGFCLNKRVFIRADLNVPQDASGRITEDTRIRASLPCIRMALDAGAAVM
VTSHLGRPAEGGFKPGDSLAPVAERLSELLGRPVSLVSSWVDGVPVEPGQLVLLENCRLN
AGEKSNDEALSRKLAALCDVFVHDAFGTAHRAEATTHGIAQFAPIACAGPLLAAEIDAIN
SALAQPERPLVAIVGGSKVSSKLTILQSLASKVDQLIVGGGIANTFMLAAGLNIGKSLAE
PGLVEEARAVIEAMKARGAEVPIPTDVVCAKSFAADAVATVKQAGDVEDDDLILDIGPDT
AARLAAQLKSAGTIVWNGPVGVFEFEAFSKGTEGIARAIAESSAFSIAGGGDTLAAIAQY
GIEKDVGYISTGGGAFLEVLEGKTLPAFEILQQHAETSAF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory