Comparing WP_011801935.1 NCBI__GCF_000015505.1:WP_011801935.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O53289 Phosphoserine phosphatase SerB2; PSP; PSPase; O-phosphoserine phosphohydrolase; Protein-serine/threonine phosphatase; EC 3.1.3.3; EC 3.1.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
43% identity, 95% coverage: 12:235/236 of query aligns to 165:384/409 of O53289
Sites not aligning to the query:
7qplA Crystal structure of phosphoserine phosphatase (serb) from brucella melitensis in complex with phosphate and magnesium
43% identity, 95% coverage: 9:232/236 of query aligns to 65:283/295 of 7qplA
A0QJI1 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Mycobacterium avium (strain 104) (see paper)
40% identity, 95% coverage: 12:235/236 of query aligns to 167:386/411 of A0QJI1
5jlpA Crystal structure of mycobacterium avium serb2 in complex with serine at act domain
40% identity, 95% coverage: 12:235/236 of query aligns to 163:382/396 of 5jlpA
Sites not aligning to the query:
8a21A Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with phenylimidazole (see paper)
40% identity, 95% coverage: 12:235/236 of query aligns to 163:382/396 of 8a21A
Sites not aligning to the query:
8a1zA Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with 1-(2,4-dichlorophenyl)-3-hydroxyurea (see paper)
40% identity, 95% coverage: 12:235/236 of query aligns to 163:382/396 of 8a1zA
1f5sA Crystal structure of phosphoserine phosphatase from methanococcus jannaschii (see paper)
38% identity, 90% coverage: 25:236/236 of query aligns to 5:210/210 of 1f5sA
Q58989 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see 3 papers)
38% identity, 90% coverage: 25:236/236 of query aligns to 6:211/211 of Q58989
1l7nA Transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) (see paper)
38% identity, 90% coverage: 25:236/236 of query aligns to 4:209/209 of 1l7nA
1l7pA Substrate bound phosphoserine phosphatase complex structure (see paper)
37% identity, 90% coverage: 25:236/236 of query aligns to 3:208/208 of 1l7pA
1l7oA Crystal structure of phosphoserine phosphatase in apo form (see paper)
36% identity, 90% coverage: 25:236/236 of query aligns to 3:200/200 of 1l7oA
3m1yC Crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori
39% identity, 85% coverage: 25:224/236 of query aligns to 4:196/208 of 3m1yC
3kd3A Crystal structure of a phosphoserine phosphohydrolase-like protein from francisella tularensis subsp. Tularensis schu s4
32% identity, 78% coverage: 25:209/236 of query aligns to 2:188/216 of 3kd3A
6hyjB Psph human phosphoserine phosphatase (see paper)
33% identity, 48% coverage: 27:139/236 of query aligns to 17:128/223 of 6hyjB
Sites not aligning to the query:
6q6jB Human phosphoserine phosphatase with substrate analogue homo-cysteic acid (see paper)
33% identity, 48% coverage: 27:139/236 of query aligns to 13:124/217 of 6q6jB
Sites not aligning to the query:
P78330 Phosphoserine phosphatase; PSP; PSPase; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Homo sapiens (Human) (see 4 papers)
33% identity, 48% coverage: 27:139/236 of query aligns to 17:128/225 of P78330
Sites not aligning to the query:
1l8oA Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase (see paper)
33% identity, 48% coverage: 27:139/236 of query aligns to 14:125/222 of 1l8oA
Sites not aligning to the query:
1l8lA Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase (see paper)
33% identity, 48% coverage: 27:139/236 of query aligns to 14:125/222 of 1l8lA
Sites not aligning to the query:
6hyyA Human phosphoserine phosphatase with serine and phosphate (see paper)
33% identity, 48% coverage: 27:139/236 of query aligns to 13:124/221 of 6hyyA
Sites not aligning to the query:
4ap9A Crystal structure of phosphoserine phosphatase from t.Onnurineus in complex with ndsb-201 (see paper)
27% identity, 78% coverage: 25:208/236 of query aligns to 10:174/200 of 4ap9A
>WP_011801935.1 NCBI__GCF_000015505.1:WP_011801935.1
MNPIEHSPGLVVNIATPDLKLRDFKLIAFDMDSTLINIECVDEIADAVGRKAEVAAITEA
AMRGEITDFKDSLRRRVALLKGVSMASMDEVYRERLKLNPGAAELVRACKDAGMKILLVS
GGFTYFTDRVKGLLDIDFTRSNVLEVRDGLLTGKMIDQSWGDICDGEEKRRMLIQTCGQL
GINPLQAIAMGDGANDLPMMGAAGLSVAYHAKPKVREQAMVAINAGGLDRLLELMR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory