Comparing WP_011802173.1 NCBI__GCF_000015505.1:WP_011802173.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
40% identity, 87% coverage: 7:261/292 of query aligns to 10:263/285 of 3ggoA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
40% identity, 87% coverage: 7:261/292 of query aligns to 10:263/286 of 3ggpA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
40% identity, 87% coverage: 7:261/292 of query aligns to 18:271/293 of 3gggD
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
39% identity, 92% coverage: 2:269/292 of query aligns to 4:272/293 of 4wjiA
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
32% identity, 96% coverage: 1:280/292 of query aligns to 8:287/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
32% identity, 94% coverage: 7:280/292 of query aligns to 6:279/365 of 6u60B
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
31% identity, 94% coverage: 9:282/292 of query aligns to 13:284/286 of 3b1fA
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
29% identity, 96% coverage: 4:283/292 of query aligns to 2:277/279 of 2f1kA
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
22% identity, 63% coverage: 60:243/292 of query aligns to 51:226/280 of 2pv7B
Sites not aligning to the query:
4om8A Crystal structure of 5-formly-3-hydroxy-2-methylpyridine 4-carboxylic acid (fhmpc) 5-dehydrogenase, an NAD+ dependent dismutase. (see paper)
35% identity, 32% coverage: 1:92/292 of query aligns to 1:111/309 of 4om8A
Sites not aligning to the query:
Q988C8 5-formyl-3-hydroxy-2-methylpyridine 4-carboxylate 5-dehydrogenase; FHMPC dehydrogenase; EC 1.2.1.100 from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) (see 2 papers)
35% identity, 32% coverage: 1:92/292 of query aligns to 1:111/309 of Q988C8
Sites not aligning to the query:
>WP_011802173.1 NCBI__GCF_000015505.1:WP_011802173.1
MFEQLGLIGCGLMGSSFALALKRAGLVRRIVGYSKSPSTTERARQMGVIDVEAPSALLAV
SGADIVLLAIPVSATEATFKAIRHLVGPDTLVMDVGSTKRDVVDAARRVLREQVGSFVPC
HPITGKEVSGVEHADVDLYAGKQVILTPIERTFTAQLKKATAVWTAMGCHVVKMSPQAHD
AAYAAVSHLPHLIAFAMINGIKSQPHGKDYMALAGPGFRDFTRIAASDPQMWRDILLANR
EELLAQSKIFQQSLQSLEQLISGGNGDGLESQIRQASETRANWRVSSHKAHK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory