SitesBLAST
Comparing WP_011802412.1 NCBI__GCF_000015505.1:WP_011802412.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4iwhA Crystal structure of a 3-isopropylmalate dehydrogenase from burkholderia pseudomallei
75% identity, 100% coverage: 1:355/356 of query aligns to 4:358/358 of 4iwhA
4xxvA Crystal structure of 3-isopropylmalate dehydrogenase from burkholderia thailandensis in complex with NAD
75% identity, 100% coverage: 1:355/356 of query aligns to 2:356/356 of 4xxvA
1a05A Crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate (see paper)
62% identity, 99% coverage: 2:355/356 of query aligns to 3:354/357 of 1a05A
Q56268 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 from Acidithiobacillus ferrooxidans (Thiobacillus ferrooxidans) (see paper)
62% identity, 99% coverage: 2:355/356 of query aligns to 3:354/358 of Q56268
- R95 (= R90) binding substrate
- R105 (= R100) binding substrate
- R133 (= R128) binding substrate
- D222 (= D222) binding Mg(2+); binding substrate
- D246 (= D246) binding Mg(2+)
P93832 3-isopropylmalate dehydrogenase 2, chloroplastic; 3-IPM-DH 2; AtIMDH2; AtIMDH3; IMDH 2; Beta-IPM dehydrogenase 2; Isopropylmalate dehydrogenase 2; AtIMD2; EC 1.1.1.85 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
56% identity, 99% coverage: 3:355/356 of query aligns to 45:397/405 of P93832
- 114:129 (vs. 68:83, 44% identical) binding NAD(+)
- L132 (≠ I86) mutation to A: Reduced activity toward 3-isopropylmalate.
- L133 (= L87) Confers substrate specificity; mutation to A: Reduced activity toward 3-isopropylmalate.; mutation to F: Enhanced activity toward 3-(2'-methylthio)-ethylmalate, but reduced catalytic efficiency with 3-isopropylmalate.
- R136 (= R90) binding substrate; mutation to A: Loss of activity toward 3-isopropylmalate.; mutation to K: Reduced activity toward 3-isopropylmalate.
- R146 (= R100) binding substrate; mutation to A: Reduced activity toward 3-isopropylmalate.; mutation to K: Reduced activity toward 3-isopropylmalate.
- R174 (= R128) binding substrate; mutation to A: Loss of activity toward 3-isopropylmalate.; mutation to K: Reduced activity toward 3-isopropylmalate.
- Y181 (= Y135) Important for catalysis; mutation Y->A,F,H: Reduced activity toward 3-isopropylmalate.
- K232 (= K190) Important for catalysis; mutation to M: Loss of activity toward 3-isopropylmalate.
- N234 (= N192) binding NAD(+); mutation N->A,D: Loss of activity toward 3-isopropylmalate.
- V235 (= V193) mutation to A: Reduced activity toward 3-isopropylmalate.
- D264 (= D222) binding Mg(2+); binding substrate; mutation to N: Loss of activity toward 3-isopropylmalate.
- N265 (= N223) binding NAD(+)
- D288 (= D246) binding Mg(2+); mutation to N: Loss of activity toward 3-isopropylmalate.
- D292 (= D250) binding Mg(2+); mutation to N: Reduced activity toward 3-isopropylmalate.
- 318:334 (vs. 276:292, 76% identical) binding NAD(+)
5j33A Isopropylmalate dehydrogenase in complex with NAD+ (see paper)
56% identity, 99% coverage: 3:355/356 of query aligns to 5:357/360 of 5j33A
- active site: Y141 (= Y135), K192 (= K190), D224 (= D222), D248 (= D246), D252 (= D250)
- binding magnesium ion: D248 (= D246), D252 (= D250)
- binding nicotinamide-adenine-dinucleotide: I74 (≠ V68), E89 (= E83), L92 (≠ I86), I261 (= I259), E278 (= E276), H281 (= H279), G282 (= G280), S283 (= S281), A284 (= A282), I287 (= I285), N294 (= N292), D335 (= D333)
5j32A Isopropylmalate dehydrogenase in complex with isopropylmalate (see paper)
56% identity, 99% coverage: 3:355/356 of query aligns to 15:367/369 of 5j32A
Q9FMT1 3-isopropylmalate dehydrogenase 1, chloroplastic; 3-IPM-DH 1; AtIMDH1; IMDH 1; Beta-IPM dehydrogenase 1; Isopropylmalate dehydrogenase 1; AtIMD1; Methylthioalkylmalate dehydrogenase 1; EC 1.1.1.85 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
56% identity, 99% coverage: 3:355/356 of query aligns to 49:401/409 of Q9FMT1
- F137 (≠ L87) Confers substrate specificity; mutation to L: Reduced activity toward 3-(2'-methylthio)-ethylmalate, but enhanced catalytic efficiency with 3-isopropylmalate.
- C232 (≠ T186) Essential for redox regulation; mutation to S: Reduced sensitivity to oxidation on enzyme activity regulation.
- C390 (≠ T344) Essential for redox regulation; mutation to S: Reduced sensitivity to oxidation on enzyme activity regulation.
Q9SA14 3-isopropylmalate dehydrogenase 3, chloroplastic; 3-IPM-DH 3; AtIMDH2; AtIMDH3; IMDH 3; Beta-IPM dehydrogenase 3; Isopropylmalate dehydrogenase 3; AtIMD3; EC 1.1.1.85 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
55% identity, 99% coverage: 2:355/356 of query aligns to 45:398/404 of Q9SA14
- L134 (= L87) Confers substrate specificity; mutation to F: Enhanced activity toward 3-(2'-methylthio)-ethylmalate, but reduced catalytic efficiency with 3-isopropylmalate.
6xxyA Crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. (see paper)
54% identity, 99% coverage: 2:355/356 of query aligns to 5:358/358 of 6xxyA
- active site: Y144 (= Y135), K194 (= K190), D226 (= D222), D250 (= D246)
- binding magnesium ion: D250 (= D246), D254 (= D250)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ A67), V75 (= V68), G76 (= G69), E90 (= E83), L94 (≠ I86), Y224 (= Y220), N227 (= N223), M230 (= M226), M263 (≠ I259), G264 (= G260), E280 (= E276), G283 (≠ H279), G284 (= G280), S285 (= S281), A286 (= A282), P287 (= P283), D288 (= D284), I289 (= I285), N296 (= N292), D337 (= D333)
- binding 2-(2-methylprop-2-enoxyamino)-2-oxidanylidene-ethanoic acid: E90 (= E83), R108 (= R100), R137 (= R128), K194 (= K190), V197 (= V193), D226 (= D222), D250 (= D246)
1cnzA 3-isopropylmalate dehydrogenase (ipmdh) from salmonella typhimurium (see paper)
52% identity, 99% coverage: 3:353/356 of query aligns to 7:357/363 of 1cnzA
P37412 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
52% identity, 99% coverage: 3:353/356 of query aligns to 7:357/363 of P37412
- D227 (= D222) binding Mn(2+)
- D251 (= D246) binding Mn(2+)
- D255 (= D250) binding Mn(2+)
3vkzA 3-isopropylmalate dehydrogenase from shewanella oneidensis mr-1 at atmospheric pressure (see paper)
54% identity, 99% coverage: 2:355/356 of query aligns to 4:360/364 of 3vkzA
2y41A Structure of isopropylmalate dehydrogenase from thermus thermophilus - complex with ipm and mn (see paper)
56% identity, 93% coverage: 1:332/356 of query aligns to 2:324/346 of 2y41A
2ztwA Structure of 3-isopropylmalate dehydrogenase in complex with the inhibitor and NAD+ (see paper)
56% identity, 93% coverage: 1:332/356 of query aligns to 1:323/345 of 2ztwA
- active site: Y139 (= Y135), K185 (= K190), D217 (= D222), D241 (= D246), D245 (= D250)
- binding magnesium ion: G203 (= G208), Y206 (= Y211), V209 (= V214)
- binding nicotinamide-adenine-dinucleotide: I11 (= I11), H273 (= H279), G274 (= G280), A276 (= A282), D278 (= D284), I279 (= I285), A285 (= A291), N286 (= N292)
Q5SIY4 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 2 papers)
56% identity, 93% coverage: 1:332/356 of query aligns to 1:323/345 of Q5SIY4
- 74:87 (vs. 70:83, 50% identical) binding NAD(+)
- Y139 (= Y135) mutation to F: Large decrease in activity and a small decrease in substrate affinity.
- 274:286 (vs. 280:292, 92% identical) binding NAD(+)
2y42D Structure of isopropylmalate dehydrogenase from thermus thermophilus - complex with nadh and mn (see paper)
56% identity, 93% coverage: 1:332/356 of query aligns to 2:324/355 of 2y42D
- active site: Y140 (= Y135), K186 (= K190), D218 (= D222), D242 (= D246), D246 (= D250)
- binding manganese (ii) ion: D242 (= D246), D246 (= D250)
- binding nicotinamide-adenine-dinucleotide: I12 (= I11), D79 (= D74), H274 (= H279), G275 (= G280), A277 (= A282), D279 (= D284), I280 (= I285), N287 (= N292)
3vmkA 3-isopropylmalate dehydrogenase from shewanella benthica db21 mt-2 (see paper)
53% identity, 99% coverage: 2:355/356 of query aligns to 10:366/369 of 3vmkA
P18869 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; Beta-IPM dehydrogenase; EC 1.1.1.85 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
45% identity, 95% coverage: 2:340/356 of query aligns to 5:356/371 of P18869
- T55 (≠ H47) modified: Phosphothreonine
Q72IW9 Isocitrate/homoisocitrate dehydrogenase; Homoisocitrate dehydrogenase; HICDH; EC 1.1.1.286 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 4 papers)
41% identity, 99% coverage: 2:355/356 of query aligns to 4:331/334 of Q72IW9
- E57 (≠ Q55) mutation to V: Confers enzyme activity with 3-isopropylmalate; when associated with I-72; M-85; A-86; T-208; Y-217; M-238 and M-310.
- ATS 70:72 (≠ VGD 68:70) binding NADH
- S72 (≠ D70) binding in other chain; mutation to I: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; M-85; A-86; T-208; Y-217; M-238 and M-310.
- R85 (vs. gap) binding in other chain; mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; A-86; T-208; Y-217; M-238 and M-310.; mutation to V: Confers low enzyme activity with 3-isopropylmalate. Reduces activity with homoisocitrate. Abolishes activity with isocitrate.
- Y86 (vs. gap) mutation to A: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; T-208; Y-217; M-238 and M-310.
- R88 (= R90) binding in other chain
- R98 (= R100) binding in other chain
- R118 (= R128) binding in other chain
- Y125 (= Y135) binding in other chain; mutation to A: Reduces catalytic efficiency with isocitrate.
- V135 (≠ E155) mutation to M: Formation of homodimers instead of homotetramers. Increased affinity for isocitrate. Reduces enzyme activity with isocitrate.
- K171 (= K190) binding (2R,3S)-homoisocitrate
- N173 (= N192) binding (2R,3S)-homoisocitrate; binding NADH
- D204 (= D222) binding Mg(2+)
- M208 (= M226) mutation to T: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; M-238 and M-310.
- F217 (= F235) mutation to Y: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; M-238 and M-310.
- D228 (= D246) binding Mg(2+)
- D232 (= D250) binding Mg(2+)
- V238 (≠ T256) mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; and M-310.
- GSAPD 261:265 (= GSAPD 280:284) binding NADH
- N273 (= N292) binding NADH
- R310 (= R330) mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; and M-238.
Query Sequence
>WP_011802412.1 NCBI__GCF_000015505.1:WP_011802412.1
MKIAILPGDGIGPEIVAEAVKVLKVLDLNFETETALVGGAAFEAYGHPLPEATLQLAKDA
DAVLFGAVGDWKYDTLDRPLRPEQAILGLRKNLGLFANFRPAICYPQLVDASSLKRELVS
GLDILIIRELTGDIYFGQPRGRRIATDGHFPGAEEAFDTMRYSRPEIERIAHVAFQAARK
RGKRVTSVDKANVLETFQLWKDVVTEIGLQYPDVALDHMYVDNAAMQLVRAPKKFDVVVT
GNMFGDILSDAAAMLTGSIGMLPSASLNDKNQGLYEPSHGSAPDIAGKGVANPLATILSA
AMMLRFSLNQPEAAARIEQAVDKVLSQGLRTPDIYSDGTTRIGTVEMGDAVVKALG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory