SitesBLAST
Comparing WP_011803356.1 NCBI__GCF_000015505.1:WP_011803356.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ydbA Crystal structure of the complex of type ii dehydroquinate dehydratase from acinetobacter baumannii with dehydroquinic acid at 1.76 angstrom resolution
47% identity, 97% coverage: 2:145/148 of query aligns to 2:145/145 of 5ydbA
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N74 (= N74), A77 (= A77), E98 (= E98), H100 (= H100), R107 (= R107)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: N74 (= N74), A76 (≠ G76), A77 (= A77), H80 (= H80), H100 (= H100), L101 (≠ M101), S102 (= S102), R111 (= R111)
5b6pB Structure of the dodecameric type-ii dehydrogenate dehydratase from acinetobacter baumannii at 2.00 a resolution (see paper)
47% identity, 97% coverage: 2:145/148 of query aligns to 2:145/145 of 5b6pB
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N74 (= N74), A77 (= A77), E98 (= E98), H100 (= H100), R107 (= R107)
- binding sulfate ion: N74 (= N74), H100 (= H100), L101 (≠ M101), S102 (= S102)
6hsaA The crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876
40% identity, 92% coverage: 1:136/148 of query aligns to 4:140/145 of 6hsaA
6hs9A The crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876
40% identity, 92% coverage: 1:136/148 of query aligns to 4:140/145 of 6hs9A
- active site: P12 (≠ I9), N13 (= N10), R20 (= R17), Y25 (= Y22), N77 (= N74), A80 (= A77), E102 (= E98), H104 (= H100), R111 (= R107)
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: R20 (= R17), Y25 (= Y22), G79 (= G76), A80 (= A77), H83 (= H80), I105 (≠ M101), S106 (= S102), R115 (= R111)
Q48255 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
40% identity, 95% coverage: 1:141/148 of query aligns to 1:143/167 of Q48255
- N76 (= N74) binding
- H82 (= H80) binding
- D89 (= D87) binding
- R113 (= R111) binding
4b6rA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
40% identity, 95% coverage: 1:141/148 of query aligns to 1:143/157 of 4b6rA
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N74), A79 (= A77), E100 (= E98), H102 (= H100), R109 (= R107)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: Y22 (= Y22), N76 (= N74), G78 (= G76), A79 (= A77), H82 (= H80), D89 (= D87), L93 (≠ I91), H102 (= H100), L103 (≠ M101), T104 (≠ S102), R113 (= R111)
4b6sA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
40% identity, 95% coverage: 1:141/148 of query aligns to 1:143/158 of 4b6sA
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N74), A79 (= A77), E100 (= E98), H102 (= H100), R109 (= R107)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N10), L14 (≠ F14), Y22 (= Y22), N76 (= N74), G78 (= G76), A79 (= A77), H82 (= H80), H102 (= H100), L103 (≠ M101), T104 (≠ S102), R113 (= R111)
2xb9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3-dehydroquinic acid (see paper)
40% identity, 95% coverage: 1:141/148 of query aligns to 1:143/158 of 2xb9A
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N74), A79 (= A77), E100 (= E98), H102 (= H100), R109 (= R107)
- binding (1r,2r,4s,5r)-1,4,5-trihydroxy-2-(4-methoxybenzyl)-3-oxocyclohexanecarboxylic acid: N10 (= N10), Y22 (= Y22), N76 (= N74), A79 (= A77), H82 (= H80), H102 (= H100), L103 (≠ M101), T104 (≠ S102), R113 (= R111)
1j2yA Crystal structure of the type ii 3-dehydroquinase (see paper)
40% identity, 95% coverage: 1:141/148 of query aligns to 1:143/158 of 1j2yA
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N74), A79 (= A77), E100 (= E98), H102 (= H100), R109 (= R107)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: Y22 (= Y22), N76 (= N74), G78 (= G76), H82 (= H80), H102 (= H100), L103 (≠ M101), T104 (≠ S102), R113 (= R111)
2xd9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
40% identity, 95% coverage: 1:141/148 of query aligns to 1:143/153 of 2xd9A
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N74), A79 (= A77), E100 (= E98), H102 (= H100), R109 (= R107)
- binding (4r,6r,7s)-4,6,7-trihydroxy-2-[(1e)-prop-1-en-1-yl]-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N10), L14 (≠ F14), Y22 (= Y22), N76 (= N74), G78 (= G76), A79 (= A77), H82 (= H80), H102 (= H100), L103 (≠ M101), T104 (≠ S102), R113 (= R111)
2wksA Structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor. (see paper)
40% identity, 95% coverage: 1:141/148 of query aligns to 1:143/153 of 2wksA
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N74), A79 (= A77), E100 (= E98), H102 (= H100), R109 (= R107)
- binding (1R,4S,5R)-1,4,5-trihydroxy-3-[(5-methyl-1-benzothiophen-2-yl)methoxy]cyclohex-2-ene-1-carboxylic acid: L11 (= L11), Y22 (= Y22), N76 (= N74), G78 (= G76), A79 (= A77), H82 (= H80), H102 (= H100), L103 (≠ M101), T104 (≠ S102), R113 (= R111)
2xdaA Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-2-(2-cyclopropyl)ethyl-4,6,7- trihydroxy-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
40% identity, 95% coverage: 1:141/148 of query aligns to 1:143/150 of 2xdaA
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N74), A79 (= A77), E100 (= E98), H102 (= H100), R109 (= R107)
- binding (4r,6r,7s)-2-(2-cyclopropylethyl)-4,6,7-trihydroxy-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N10), L11 (= L11), M13 (= M13), Y22 (= Y22), N76 (= N74), A79 (= A77), H82 (= H80), H102 (= H100), L103 (≠ M101), T104 (≠ S102), R113 (= R111)
2c4wA Type ii dehydroquinase from h. Pylori in complex with ah9095 (see paper)
40% identity, 95% coverage: 1:141/148 of query aligns to 10:152/168 of 2c4wA
- active site: P18 (≠ I9), N19 (= N10), R26 (= R17), Y31 (= Y22), N85 (= N74), A88 (= A77), E109 (= E98), H111 (= H100), R118 (= R107)
- binding n-tetrazol-5-yl 9-oxo-9h-xanthene-2 sulphonamide: L20 (= L11), L23 (≠ F14), D27 (= D18), G87 (= G76), H91 (= H80), H111 (= H100), L112 (≠ M101), T113 (≠ S102), I115 (= I104), R122 (= R111)
3n76A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with compound 5 (see paper)
44% identity, 90% coverage: 5:137/148 of query aligns to 6:137/143 of 3n76A
- active site: P10 (≠ I9), N11 (= N10), R18 (= R17), Y23 (= Y22), N74 (= N74), G77 (≠ A77), E98 (= E98), H100 (= H100), R107 (= R107)
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: N11 (= N10), R14 (≠ M13), R18 (= R17), Y23 (= Y22), N74 (= N74), G76 (= G76), G77 (≠ A77), H80 (= H80), H100 (= H100), I101 (≠ M101), S102 (= S102), R111 (= R111)
4b6pA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
44% identity, 90% coverage: 5:137/148 of query aligns to 5:136/142 of 4b6pA
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N74), G76 (≠ A77), E97 (= E98), H99 (= H100), R106 (= R107)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N10), L14 (≠ F14), R17 (= R17), Y22 (= Y22), N73 (= N74), G75 (= G76), G76 (≠ A77), H79 (= H80), H99 (= H100), I100 (≠ M101), S101 (= S102), R110 (= R111)
3n8kM Type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid (see paper)
44% identity, 90% coverage: 5:137/148 of query aligns to 14:145/151 of 3n8kM
- active site: P18 (≠ I9), N19 (= N10), N82 (= N74), G85 (≠ A77), E106 (= E98), H108 (= H100), R115 (= R107)
- binding 2,6-dioxo-1,2,3,6-tetrahydropyridine-4-carboxylic acid: R26 (= R17), Y31 (= Y22), N82 (= N74), G84 (= G76), H88 (= H80), H108 (= H100), I109 (≠ M101), S110 (= S102), R119 (= R111)
4cl0A Structure of the mycobacterium tuberculosis type ii dehydroquinase inhibited by a 3-dehydroquinic acid derivative
44% identity, 90% coverage: 5:137/148 of query aligns to 5:136/140 of 4cl0A
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N74), G76 (≠ A77), E97 (= E98), H99 (= H100), R106 (= R107)
- binding (2r)-2-methyl-3-dehydroquinic acid: R17 (= R17), Y22 (= Y22), N73 (= N74), G75 (= G76), G76 (≠ A77), H79 (= H80), H99 (= H100), I100 (≠ M101), S101 (= S102), R110 (= R111)
4b6oA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
44% identity, 90% coverage: 5:137/148 of query aligns to 6:137/142 of 4b6oA
- active site: P10 (≠ I9), N11 (= N10), R18 (= R17), Y23 (= Y22), N74 (= N74), G77 (≠ A77), E98 (= E98), H100 (= H100), R107 (= R107)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N11 (= N10), N74 (= N74), G76 (= G76), G77 (≠ A77), H80 (= H80), H100 (= H100), I101 (≠ M101), S102 (= S102), R111 (= R111)
3n59C Type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate (see paper)
44% identity, 90% coverage: 5:137/148 of query aligns to 6:137/142 of 3n59C
- active site: P10 (≠ I9), N11 (= N10), R18 (= R17), N74 (= N74), G77 (≠ A77), E98 (= E98), H100 (= H100), R107 (= R107)
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: R18 (= R17), Y23 (= Y22), G76 (= G76), G77 (≠ A77), H80 (= H80), H100 (= H100), I101 (≠ M101), S102 (= S102), R111 (= R111)
4kiwA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49e [5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid] (see paper)
44% identity, 90% coverage: 5:137/148 of query aligns to 5:136/141 of 4kiwA
- active site: P9 (≠ I9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N74), G76 (≠ A77), E97 (= E98), H99 (= H100), R106 (= R107)
- binding 5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid: N10 (= N10), L11 (= L11), R13 (≠ M13), L14 (≠ F14), Y22 (= Y22), N73 (= N74), G75 (= G76), G76 (≠ A77), H79 (= H80), H99 (= H100), I100 (≠ M101), S101 (= S102), V103 (≠ I104), R110 (= R111)
Query Sequence
>WP_011803356.1 NCBI__GCF_000015505.1:WP_011803356.1
MNILMLHGINLNMFGKRDPKQYGTITLDEINARVGALGQELGATVEAFQTNSEGAMCERI
HQAYADGVDAVMINAGAWTHYSYGIRDALAILTCPIVELHMSNIHAREAFRHVSVFGEIV
RGQICGFGADSYLLGLRAAVSAAQAGRV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory