Comparing WP_011814831.1 NCBI__GCF_000015585.1:WP_011814831.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
44% identity, 98% coverage: 6:388/389 of query aligns to 3:378/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
31% identity, 88% coverage: 44:385/389 of query aligns to 30:363/366 of Q8P8J5
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
26% identity, 98% coverage: 5:384/389 of query aligns to 2:375/380 of 5vo3A
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
31% identity, 88% coverage: 44:385/389 of query aligns to 31:358/360 of 2f7vA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
26% identity, 95% coverage: 14:384/389 of query aligns to 11:371/377 of P44514
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 92% coverage: 30:388/389 of query aligns to 24:382/383 of 7uoiA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
28% identity, 70% coverage: 10:282/389 of query aligns to 7:270/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
28% identity, 70% coverage: 10:282/389 of query aligns to 7:270/376 of 4o23A
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 61% coverage: 46:284/389 of query aligns to 45:290/408 of Q03154
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
26% identity, 83% coverage: 65:387/389 of query aligns to 48:374/377 of 7t1qA
7lgpB Dape enzyme from shigella flexneri
25% identity, 99% coverage: 2:387/389 of query aligns to 2:375/377 of 7lgpB
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
26% identity, 85% coverage: 59:388/389 of query aligns to 80:421/426 of 3pfoA
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 61% coverage: 46:284/389 of query aligns to 45:289/407 of P37111
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
30% identity, 60% coverage: 7:238/389 of query aligns to 2:213/258 of 4h2kA
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
31% identity, 27% coverage: 46:151/389 of query aligns to 39:144/192 of 1q7lA
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
26% identity, 78% coverage: 79:381/389 of query aligns to 57:331/341 of 5xoyA
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
31% identity, 22% coverage: 74:160/389 of query aligns to 122:211/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
31% identity, 22% coverage: 74:160/389 of query aligns to 91:180/471 of 3dljA
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
26% identity, 44% coverage: 10:179/389 of query aligns to 25:190/458 of 2pokA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
33% identity, 35% coverage: 14:149/389 of query aligns to 11:135/265 of 4op4B
Sites not aligning to the query:
>WP_011814831.1 NCBI__GCF_000015585.1:WP_011814831.1
MALPAPALREMIAELVAEPSVSSVEADHDQGNRGITERLAGWLEGLGFDCRIQPLPGRPD
KTNLIATLAPARGPARGGLALCGHTDTVPCDPERWTGDPWRLREADGRLYGLGVTDMKAF
LAVAVEAAREVDPARLQAPLTLLFTADEESGMDGVRALLDAHPQGLGPRHAVVGEPTRNH
PVHVHKGMMMEALHIQGRAGHSSDPRLGRNALDAMTRVLNALIAWREELAANHHDARFAV
PQPTLNLGHIRGGDNPNRICGEAELHIDLRPLPGMDPAELQQTLDRRLAEALGDDAVHLT
RRPLFPAHPPMATPADAEVVRYAETVTGHPAGAVAFATEAPYLARLGMDVVVLGPGEIEQ
AHQPDESIDVERLAPTVALLRRFIHRFCL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory