SitesBLAST
Comparing WP_011841527.1 NCBI__GCF_000015985.1:WP_011841527.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5g3yA Crystal structure of adenylate kinase ancestor 1 with zn and adp bound (see paper)
49% identity, 91% coverage: 14:221/229 of query aligns to 3:213/213 of 5g3yA
- binding adenosine-5'-diphosphate: P9 (= P20), G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), T31 (= T42), G32 (= G43), R36 (= R47), M53 (= M64), E57 (≠ G68), L58 (= L69), V59 (= V70), T64 (≠ V75), G85 (= G96), R88 (= R99), Q92 (= Q103), R123 (= R134), R127 (= R138), R127 (= R138), T136 (≠ G147), Y137 (= Y148), H138 (= H149), F141 (= F152), R160 (= R172), I201 (= I213)
- binding zinc ion: C130 (= C141), C133 (= C144), C150 (= C161), C153 (= C164)
5g3zA Crystal structure of adenylate kinase ancestor 3 with zn, mg and ap5a bound (see paper)
43% identity, 93% coverage: 14:225/229 of query aligns to 3:213/215 of 5g3zA
- binding bis(adenosine)-5'-pentaphosphate: P9 (= P20), G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), T31 (= T42), R36 (= R47), M53 (= M64), E57 (≠ G68), V59 (= V70), T64 (≠ V75), G85 (= G96), R88 (= R99), Q92 (= Q103), R123 (= R134), R127 (= R138), T136 (≠ G147), Y137 (= Y148), H138 (= H149), F141 (= F152), R160 (= R172), R171 (= R183), I201 (= I213)
- binding zinc ion: C130 (= C141), C133 (= C144), C150 (= C161), C153 (= C164)
5g40A Crystal structure of adenylate kinase ancestor 4 with zn and amp-adp bound (see paper)
43% identity, 93% coverage: 14:225/229 of query aligns to 3:213/215 of 5g40A
- binding adenosine-5'-diphosphate: G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), R123 (= R134), R127 (= R138), T136 (≠ G147), Y137 (= Y148), H138 (= H149), F141 (= F152), I201 (= I213)
- binding adenosine monophosphate: T31 (= T42), G32 (= G43), F35 (≠ L46), R36 (= R47), M53 (= M64), E57 (≠ G68), V59 (= V70), T64 (≠ V75), G85 (= G96), R88 (= R99), Q92 (= Q103), R160 (= R172)
- binding zinc ion: C130 (= C141), C133 (= C144), C150 (= C161), D153 (≠ C164)
1s3gA Crystal structure of adenylate kinase from bacillus globisporus (see paper)
43% identity, 92% coverage: 14:224/229 of query aligns to 3:212/217 of 1s3gA
- active site: K13 (= K24), R88 (= R99), R127 (= R138), R160 (= R172), R171 (= R183)
- binding bis(adenosine)-5'-pentaphosphate: G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), T31 (= T42), G32 (= G43), R36 (= R47), M53 (= M64), A57 (≠ G68), L58 (= L69), V59 (= V70), T64 (≠ V75), R88 (= R99), Q92 (= Q103), R123 (= R134), R127 (= R138), S136 (≠ G147), Y137 (= Y148), H138 (= H149), R160 (= R172), R171 (= R183), K199 (≠ G211), I201 (= I213)
- binding zinc ion: C130 (= C141), C133 (= C144), C150 (= C161), D153 (≠ C164)
P84139 Adenylate kinase; AK; ATP-AMP transphosphorylase; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; EC 2.7.4.3 from Sporosarcina globispora (Bacillus globisporus) (see paper)
43% identity, 92% coverage: 14:224/229 of query aligns to 3:212/217 of P84139
- GAGKGT 10:15 (= GAGKGT 21:26) binding
- 30:59 (vs. 41:70, 53% identical) NMP
- T31 (= T42) binding
- R36 (= R47) binding
- ALV 57:59 (≠ GLV 68:70) binding
- GFPR 85:88 (= GFPR 96:99) binding
- Q92 (= Q103) binding
- 126:163 (vs. 137:175, 49% identical) LID
- R127 (= R138) binding
- C130 (= C141) binding
- C133 (= C144) binding
- SY 136:137 (≠ GY 147:148) binding
- C150 (= C161) binding
- D153 (≠ C164) binding
- R160 (= R172) binding
- R171 (= R183) binding
- K199 (≠ G211) binding
Q9U915 Adenylate kinase; ATP-AMP transphosphorylase; ATP:AMP phosphotransferase; Adenylate kinase cytosolic and mitochondrial; Adenylate monophosphate kinase; EC 2.7.4.3 from Drosophila melanogaster (Fruit fly) (see paper)
43% identity, 93% coverage: 15:226/229 of query aligns to 22:232/240 of Q9U915
- S48 (= S41) modified: Phosphoserine
3fb4A Crystal structure of adenylate kinase from marinibacillus marinus (see paper)
41% identity, 93% coverage: 14:225/229 of query aligns to 3:213/215 of 3fb4A
- active site: K13 (= K24), R88 (= R99), R127 (= R138), R160 (= R172), R171 (= R183)
- binding bis(adenosine)-5'-pentaphosphate: G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), T31 (= T42), G32 (= G43), R36 (= R47), M53 (= M64), N57 (≠ G68), V59 (= V70), T64 (≠ V75), G85 (= G96), R88 (= R99), Q92 (= Q103), R123 (= R134), R127 (= R138), T136 (≠ G147), Y137 (= Y148), H138 (= H149), F141 (= F152), R160 (= R172), R171 (= R183), Q199 (≠ G211), I201 (= I213)
- binding zinc ion: C130 (= C141), C133 (= C144), C150 (= C161), D153 (≠ C164)
1akyA High-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer (see paper)
46% identity, 86% coverage: 14:209/229 of query aligns to 5:200/218 of 1akyA
- active site: K15 (= K24), R91 (= R99), R130 (= R138), R163 (= R172), R174 (= R183)
- binding bis(adenosine)-5'-pentaphosphate: G12 (= G21), G14 (= G23), K15 (= K24), G16 (= G25), T17 (= T26), T33 (= T42), R38 (= R47), M55 (= M64), G59 (= G68), V61 (= V70), M66 (≠ V75), G88 (= G96), R91 (= R99), Q95 (= Q103), R126 (= R134), R130 (= R138), S139 (≠ G147), Y140 (= Y148), H141 (= H149), R163 (= R172), R174 (= R183)
- binding imidazole: G16 (= G25), D87 (= D95)
Sites not aligning to the query:
P07170 Adenylate kinase; ATP-AMP transphosphorylase; ATP:AMP phosphotransferase; Adenylate kinase cytosolic and mitochondrial; Adenylate monophosphate kinase; EC 2.7.4.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
46% identity, 86% coverage: 14:209/229 of query aligns to 9:204/222 of P07170
- GAGKGT 16:21 (= GAGKGT 21:26) binding
- 36:65 (vs. 41:70, 53% identical) NMP
- T37 (= T42) binding
- R42 (= R47) binding
- GLV 63:65 (= GLV 68:70) binding
- GFPR 92:95 (= GFPR 96:99) binding
- Q99 (= Q103) binding
- 133:170 (vs. 137:175, 33% identical) LID
- R134 (= R138) binding
- SY 143:144 (≠ GY 147:148) binding
- R167 (= R172) binding
- R178 (= R183) binding
Sites not aligning to the query:
- 2 modified: propeptide, Removed in mature form
- 3 modified: N-acetylserine
- 206 binding
P27142 Adenylate kinase; AK; ATP-AMP transphosphorylase; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; EC 2.7.4.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
41% identity, 93% coverage: 14:225/229 of query aligns to 3:213/217 of P27142
- GAGKGT 10:15 (= GAGKGT 21:26) binding
- 30:59 (vs. 41:70, 57% identical) NMP
- T31 (= T42) binding
- R36 (= R47) binding
- DLV 57:59 (≠ GLV 68:70) binding
- GFPR 85:88 (= GFPR 96:99) binding
- Q92 (= Q103) binding
- 126:163 (vs. 137:175, 54% identical) LID
- R127 (= R138) binding
- C130 (= C141) binding
- C133 (= C144) binding
- TY 136:137 (≠ GY 147:148) binding
- C150 (= C161) binding
- C153 (= C164) binding
- R160 (= R172) binding
- R171 (= R183) binding
- Q199 (≠ G211) binding
3be4A Crystal structure of cryptosporidium parvum adenylate kinase cgd5_3360
41% identity, 92% coverage: 14:224/229 of query aligns to 8:215/215 of 3be4A
- active site: K18 (= K24), R91 (= R99), R130 (= R138), R163 (= R172), R174 (= R183)
- binding bis(adenosine)-5'-pentaphosphate: P14 (= P20), G15 (= G21), G17 (= G23), K18 (= K24), G19 (= G25), T20 (= T26), T36 (= T42), G37 (= G43), L40 (= L46), R41 (= R47), N60 (≠ G68), F61 (≠ L69), V62 (= V70), G88 (= G96), R91 (= R99), Q95 (= Q103), R126 (= R134), R130 (= R138), I139 (≠ G147), Y140 (= Y148), H141 (= H149), Y144 (≠ F152), R163 (= R172), R174 (= R183), P204 (≠ I213)
1dvrA Structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp (see paper)
45% identity, 86% coverage: 14:209/229 of query aligns to 7:202/220 of 1dvrA
- active site: K17 (= K24), R93 (= R99), R132 (= R138), I165 (≠ R172), R176 (= R183)
- binding phosphodifluoromethylphosphonic acid-adenylate ester: P13 (= P20), G14 (= G21), G16 (= G23), K17 (= K24), G18 (= G25), T19 (= T26), K55 (≠ A62), Q59 (≠ A66), R128 (= R134), R132 (= R138), S141 (≠ G147), Y142 (= Y148), H143 (= H149)
Sites not aligning to the query:
4qbhA Crystal structure of a stable adenylate kinase variant aklse5 (see paper)
42% identity, 93% coverage: 14:225/229 of query aligns to 3:213/217 of 4qbhA
- active site: K13 (= K24), R88 (= R99), R127 (= R138), R160 (= R172), R171 (= R183)
- binding bis(adenosine)-5'-pentaphosphate: G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), T31 (= T42), G32 (= G43), F35 (≠ L46), R36 (= R47), M53 (= M64), D57 (≠ G68), V59 (= V70), T64 (≠ V75), G85 (= G96), R88 (= R99), Q92 (= Q103), R123 (= R134), R127 (= R138), T136 (≠ G147), Y137 (= Y148), H138 (= H149), F141 (= F152), R160 (= R172), R171 (= R183), Q199 (≠ G211), M201 (≠ I213)
- binding zinc ion: C130 (= C141), C133 (= C144), C150 (= C161), C153 (= C164)
4k46A Crystal structure of adenylate kinase from photobacterium profundum
47% identity, 91% coverage: 14:222/229 of query aligns to 3:211/214 of 4k46A
- active site: K13 (= K24), R88 (= R99), R123 (= R138), R156 (= R172), R167 (= R183)
- binding adenosine-5'-diphosphate: G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), R119 (= R134), M120 (≠ V135), R123 (= R138), T132 (≠ G147), Y133 (= Y148), H134 (= H149), Y137 (≠ F152), K200 (≠ G211), V202 (≠ I213)
- binding adenosine monophosphate: T31 (= T42), G32 (= G43), L35 (= L46), R36 (= R47), I53 (≠ M64), Q57 (≠ G68), V59 (= V70), I64 (≠ V75), R88 (= R99), Q92 (= Q103)
P08166 Adenylate kinase 2, mitochondrial; AK 2; ATP-AMP transphosphorylase 2; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; EC 2.7.4.3 from Bos taurus (Bovine) (see 2 papers)
42% identity, 90% coverage: 15:220/229 of query aligns to 21:225/241 of P08166
- C44 (≠ V38) modified: Disulfide link with 94
- C94 (≠ V88) modified: Disulfide link with 44
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; alternate
3sr0A Crystal structure of the phosphoryl transfer transition state mimic in the adenylate kinase: adp/alf4/amp in the active site (see paper)
41% identity, 93% coverage: 13:225/229 of query aligns to 2:203/203 of 3sr0A
- active site: K13 (= K24), R85 (= R99), R124 (= R138), R150 (= R172), R161 (= R183)
- binding adenosine-5'-diphosphate: G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), R120 (= R134), R124 (= R138), V133 (≠ G147), Y134 (= Y148), H135 (= H149), Y138 (≠ F152), V191 (≠ I213)
- binding tetrafluoroaluminate ion: R124 (= R138), R161 (= R183)
- binding adenosine monophosphate: T31 (= T42), G32 (= G43), L35 (= L46), R36 (= R47), M53 (= M64), E57 (≠ G68), V59 (= V70), I64 (≠ V75), G82 (= G96), R85 (= R99), Q89 (= Q103), R150 (= R172), R161 (= R183)
2rgxA Crystal structure of adenylate kinase from aquifex aeolicus in complex with ap5a (see paper)
41% identity, 93% coverage: 13:225/229 of query aligns to 2:203/203 of 2rgxA
- active site: K13 (= K24), R85 (= R99), R124 (= R138), R150 (= R172), R161 (= R183)
- binding bis(adenosine)-5'-pentaphosphate: P9 (= P20), G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), T31 (= T42), G32 (= G43), L35 (= L46), E57 (≠ G68), L58 (= L69), V59 (= V70), I64 (≠ V75), G82 (= G96), R85 (= R99), Q89 (= Q103), R120 (= R134), R124 (= R138), Y134 (= Y148), H135 (= H149), Y138 (≠ F152), R161 (= R183), V191 (≠ I213)
- binding zinc ion: E95 (≠ G109), E98 (= E112), E163 (≠ A185), E167 (≠ A189)
4ikeA Crystal structure of a partly open atp-lid of liganded adenylate kinase
41% identity, 93% coverage: 13:225/229 of query aligns to 2:203/206 of 4ikeA
- active site: K13 (= K24), R85 (= R99), R124 (= R138), R150 (= R172), R161 (= R183)
- binding adenosine-5'-diphosphate: G10 (= G21), G12 (= G23), K13 (= K24), G14 (= G25), T15 (= T26), R120 (= R134), R124 (= R138), Y134 (= Y148), H135 (= H149), Y138 (≠ F152), V191 (≠ I213)
- binding adenosine monophosphate: T31 (= T42), L35 (= L46), R36 (= R47), M53 (= M64), E57 (≠ G68), L58 (= L69), V59 (= V70), I64 (≠ V75), R85 (= R99), Q89 (= Q103)
O66490 Adenylate kinase; AK; ATP-AMP transphosphorylase; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; EC 2.7.4.3 from Aquifex aeolicus (strain VF5) (see paper)
41% identity, 93% coverage: 13:225/229 of query aligns to 2:203/206 of O66490
- GAGKGT 10:15 (= GAGKGT 21:26) binding
- 30:59 (vs. 41:70, 63% identical) NMP
- T31 (= T42) binding
- ELV 57:59 (≠ GLV 68:70) binding
- GFPR 82:85 (= GFPR 96:99) binding
- Q89 (= Q103) binding
- R120 (= R134) binding
- 123:153 (vs. 137:175, 28% identical) LID
- R124 (= R138) binding
- VY 133:134 (≠ GY 147:148) binding
- R161 (= R183) binding
- K189 (≠ G211) binding
P54819 Adenylate kinase 2, mitochondrial; AK 2; ATP-AMP transphosphorylase 2; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; EC 2.7.4.3 from Homo sapiens (Human)
42% identity, 90% coverage: 15:220/229 of query aligns to 19:223/239 of P54819
- GAGKGT 25:30 (= GAGKGT 21:26) binding
- C42 (≠ V38) modified: Disulfide link with 92
- 45:74 (vs. 41:70, 57% identical) NMP
- C92 (≠ V88) modified: Disulfide link with 42
- R138 (= R134) binding
- 141:178 (vs. 137:175, 33% identical) LID
- SY 151:152 (≠ GY 147:148) binding
- R175 (= R172) binding
- Q214 (≠ G211) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; alternate
Query Sequence
>WP_011841527.1 NCBI__GCF_000015985.1:WP_011841527.1
MEGVTETTTRPPVLILLGPPGAGKGTQARMLEERFGLVQLSTGDLLRAAVAAGTPAGMAA
KAVMEAGGLVSDEIVLAILADRMAQPDVARGIILDGFPRTAGQAAALDGLLERAGQRVTA
AISLEVDDGAMVERVSGRSTCAACGEGYHDSFKQPARAGTCDKCGGTEFKRRPDDNADTV
GARLAAYHAQTAPLIAYYDGCGVLERIDAMGAIDEIASALGRIVGRVSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory