Comparing WP_011867822.1 NCBI__GCF_000016125.1:WP_011867822.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O58965 Phosphoglycerate kinase; EC 2.7.2.3 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
44% identity, 99% coverage: 3:413/414 of query aligns to 2:406/410 of O58965
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
39% identity, 97% coverage: 3:402/414 of query aligns to 3:390/398 of 1vpeA
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
38% identity, 98% coverage: 3:407/414 of query aligns to 4:396/654 of P36204
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
37% identity, 98% coverage: 4:407/414 of query aligns to 5:393/394 of 1phpA
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
37% identity, 98% coverage: 4:407/414 of query aligns to 5:393/394 of P18912
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
37% identity, 98% coverage: 4:407/414 of query aligns to 5:393/394 of P40924
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
36% identity, 98% coverage: 2:407/414 of query aligns to 3:388/392 of 4feyA
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
34% identity, 98% coverage: 4:407/414 of query aligns to 8:418/440 of P07378
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
34% identity, 98% coverage: 4:407/414 of query aligns to 4:414/415 of 16pkA
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
34% identity, 98% coverage: 4:407/414 of query aligns to 4:414/415 of 13pkA
P0A799 Phosphoglycerate kinase; EC 2.7.2.3 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 99% coverage: 3:411/414 of query aligns to 4:387/387 of P0A799
Sites not aligning to the query:
1zmrA Crystal structure of the e. Coli phosphoglycerate kinase (see paper)
35% identity, 99% coverage: 3:411/414 of query aligns to 3:386/386 of 1zmrA
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
34% identity, 98% coverage: 2:407/414 of query aligns to 2:386/389 of 4ng4B
2paaA Crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg (see paper)
37% identity, 98% coverage: 3:406/414 of query aligns to 3:411/413 of 2paaA
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
37% identity, 98% coverage: 3:406/414 of query aligns to 7:415/417 of P09041
O60101 Phosphoglycerate kinase; EC 2.7.2.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 98% coverage: 3:406/414 of query aligns to 7:412/414 of O60101
Sites not aligning to the query:
3zlbA Crystal structure of phosphoglycerate kinase from streptococcus pneumoniae (see paper)
34% identity, 98% coverage: 3:407/414 of query aligns to 4:397/398 of 3zlbA
Sites not aligning to the query:
6yjeA Plasmoodium vivax phosphoglycerate kinase bound to nitrofuran inhibitor from peg3350 and ammonium acetate at ph 5.5
35% identity, 98% coverage: 3:406/414 of query aligns to 6:414/416 of 6yjeA
P00560 Phosphoglycerate kinase; EC 2.7.2.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
34% identity, 98% coverage: 3:407/414 of query aligns to 7:414/416 of P00560
1qpgA 3-phosphoglycerate kinase, mutation r65q (see paper)
33% identity, 98% coverage: 3:407/414 of query aligns to 6:413/415 of 1qpgA
>WP_011867822.1 NCBI__GCF_000016125.1:WP_011867822.1
MFLTLDDFELEGKTVALRVDINSPIDVNTGDILDDTRIKACYDTITGLSKKGAKVVILAH
QSRPGKKDFTTLEAHAKKLSEVLNMEVTHVDGLICASARDAILSMDNGEIILLENVRLLA
EEVLSDWKSWEAITPEKQAKTVMIKKLHPFFDYFVNDAFAAAHRAQPSLVGFSYYVPMLC
GRVMEKELFTLTKVLKNPERPCVFALGGAKADDSIEVLKNVLEKQTADQVLTSGVVANIF
LVAKGYKIGPNENLIADMGYTGQIEIAKELISKYGDKIVVPIDAGLNVDGERVEKELDIN
EEITHPIHDMGENTMKLYEEILKNAKTIVANGPAGVFENKNFLKGTEELLKSVANSEGFS
VIGGGHLSAAAEVVGLAGKMGHISTGGGACIEFLAGKKLPVIEMLSESYEKHKI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory