Comparing WP_011868435.1 NCBI__GCF_000016125.1:WP_011868435.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
65% identity, 97% coverage: 8:460/467 of query aligns to 2:435/438 of 6zhkA
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
46% identity, 97% coverage: 9:463/467 of query aligns to 3:445/448 of 3du4A
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
46% identity, 97% coverage: 9:463/467 of query aligns to 3:445/448 of P53555
6wnnA Bacillus subtilis bioa in complex with amino donor l-lys
43% identity, 97% coverage: 10:461/467 of query aligns to 1:415/420 of 6wnnA
3dodA Crystal structure of plp bound 7,8-diaminopelargonic acid synthase in bacillus subtilis (see paper)
42% identity, 97% coverage: 9:463/467 of query aligns to 1:414/417 of 3dodA
6s54A Transaminase from pseudomonas fluorescens (see paper)
32% identity, 94% coverage: 12:448/467 of query aligns to 5:438/453 of 6s54A
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
31% identity, 97% coverage: 8:462/467 of query aligns to 4:457/458 of 3fcrA
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
31% identity, 99% coverage: 4:463/467 of query aligns to 1:448/448 of 6io1B
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
31% identity, 94% coverage: 20:460/467 of query aligns to 13:447/449 of 5lh9D
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
31% identity, 94% coverage: 20:460/467 of query aligns to 11:445/447 of 5lhaA
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
28% identity, 97% coverage: 8:462/467 of query aligns to 6:457/458 of 3gjuA
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
30% identity, 97% coverage: 9:460/467 of query aligns to 1:444/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
30% identity, 97% coverage: 9:460/467 of query aligns to 1:444/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
30% identity, 97% coverage: 9:460/467 of query aligns to 1:444/453 of 6g4dB
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
29% identity, 98% coverage: 9:464/467 of query aligns to 4:448/450 of 6gwiB
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 95% coverage: 22:466/467 of query aligns to 58:495/504 of Q94CE5
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
28% identity, 98% coverage: 9:464/467 of query aligns to 7:459/460 of 5kr6B
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
30% identity, 98% coverage: 7:464/467 of query aligns to 4:456/458 of 5kr3A
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
31% identity, 92% coverage: 22:452/467 of query aligns to 16:438/459 of D6R3B6
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
31% identity, 97% coverage: 7:460/467 of query aligns to 2:423/429 of 6ed7A
>WP_011868435.1 NCBI__GCF_000016125.1:WP_011868435.1
MKSKNYSKNDLEKWDKEYVWHPFTQMKEYSEGNPLLIESGEGIYLIDVNGKRYMDAVSSI
WCNFFGHSEKRIADAISKQALKIGHSTQLGCGNVPSAILAKRYVDFSPKQFTKVFFSEDG
AEAVEIAVKMAFEYCKLKGLTNKTKFVSVKEGYHGDTVGAMSVGGSELFHGCFEPLLFDG
YHASAPFCYRCEYCNFKDTDERNKLGCEMKCLKEMEDLIRTNKDEIFCVILEAGVMGSAG
MIPYPKGYIEGVAKICKELDIILILDEIATFGRLGRAFYSDIDELKELEKPDIVCLGKGI
TGGYLPLALTLATDEIHDAFLGSFDECKQLFHGHTYAGNQIICASAIETLNILEETNICE
EIRPNIKLLHENLDKLKEFPCVGDIRKSGYMIGIELVKNKETKEPYDYGYKAGYKTAGRL
LEKGIYIRPIGNTLIFVLPLVIKPEEIELLTQKIYESISELLNEKIL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory