SitesBLAST
Comparing WP_011868824.1 NCBI__GCF_000016125.1:WP_011868824.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yb4A Crystal structure of homoisocitrate dehydrogenase from thermus thermophilus in complex with homoisocitrate, magnesium ion (ii) and nadh
52% identity, 98% coverage: 2:326/330 of query aligns to 2:326/333 of 4yb4A
- active site: Y124 (= Y119), K170 (= K170), D203 (= D203), D227 (= D227), D231 (= D231)
- binding (1R,2S)-1-hydroxybutane-1,2,4-tricarboxylic acid: S71 (≠ E71), R84 (≠ V78), R87 (= R81), R97 (= R91), R117 (= R112), Y124 (= Y119), D227 (= D227)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I12 (= I12), A69 (= A69), T70 (≠ G70), S71 (≠ E71), I201 (≠ Y201), N204 (≠ A204), L240 (= L240), E256 (= E256), H259 (= H259), G260 (= G260), S261 (= S261), A262 (= A262), D264 (= D264), I265 (= I265), N272 (= N272), D312 (= D312)
3asjB Crystal structure of homoisocitrate dehydrogenase in complex with a designed inhibitor (see paper)
52% identity, 98% coverage: 2:326/330 of query aligns to 2:326/333 of 3asjB
- active site: Y124 (= Y119), K170 (= K170), D203 (= D203), D227 (= D227), D231 (= D231)
- binding (2Z)-3-[(carboxymethyl)sulfanyl]-2-hydroxyprop-2-enoic acid: R84 (≠ V78), R97 (= R91), R117 (= R112), Y124 (= Y119), D227 (= D227), D231 (= D231), V258 (≠ I258)
3asjA Crystal structure of homoisocitrate dehydrogenase in complex with a designed inhibitor (see paper)
52% identity, 98% coverage: 2:326/330 of query aligns to 2:326/333 of 3asjA
Q72IW9 Isocitrate/homoisocitrate dehydrogenase; Homoisocitrate dehydrogenase; HICDH; EC 1.1.1.286 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 4 papers)
52% identity, 98% coverage: 2:326/330 of query aligns to 3:327/334 of Q72IW9
- E57 (≠ N56) mutation to V: Confers enzyme activity with 3-isopropylmalate; when associated with I-72; M-85; A-86; T-208; Y-217; M-238 and M-310.
- ATS 70:72 (≠ AGE 69:71) binding
- S72 (≠ E71) binding in other chain; mutation to I: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; M-85; A-86; T-208; Y-217; M-238 and M-310.
- R85 (≠ V78) binding in other chain; mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; A-86; T-208; Y-217; M-238 and M-310.; mutation to V: Confers low enzyme activity with 3-isopropylmalate. Reduces activity with homoisocitrate. Abolishes activity with isocitrate.
- Y86 (≠ K79) mutation to A: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; T-208; Y-217; M-238 and M-310.
- R88 (= R81) binding in other chain
- R98 (= R91) binding in other chain
- R118 (= R112) binding in other chain
- Y125 (= Y119) binding in other chain; mutation to A: Reduces catalytic efficiency with isocitrate.
- V135 (= V130) mutation to M: Formation of homodimers instead of homotetramers. Increased affinity for isocitrate. Reduces enzyme activity with isocitrate.
- K171 (= K170) binding
- N173 (= N172) binding ; binding
- D204 (= D203) binding
- M208 (= M207) mutation to T: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; M-238 and M-310.
- F217 (= F216) mutation to Y: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; M-238 and M-310.
- D228 (= D227) binding
- D232 (= D231) binding
- V238 (= V237) mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; and M-310.
- GSAPD 261:265 (= GSAPD 260:264) binding
- N273 (= N272) binding
- R310 (≠ T309) mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; and M-238.
6lkyA Crystal structure of isocitrate dehydrogenase from methylococcus capsulatus
43% identity, 100% coverage: 1:330/330 of query aligns to 1:337/339 of 6lkyA
- active site: Y123 (= Y119), K174 (= K170), D207 (= D203), D231 (= D227)
- binding nicotinamide-adenine-dinucleotide: P68 (≠ A69), L69 (≠ G70), T71 (= T72), N81 (≠ I77), H263 (= H259), G264 (= G260), S265 (= S261), A266 (= A262), D268 (= D264), I269 (= I265), N276 (= N272)
4y1pB Crystal structure of 3-isopropylmalate dehydrogenase (saci_0600) from sulfolobus acidocaldarius complex with 3-isopropylmalate and mg2+ (see paper)
44% identity, 99% coverage: 4:330/330 of query aligns to 4:335/336 of 4y1pB
O14104 Homoisocitrate dehydrogenase; HICDH; EC 1.1.1.87 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
43% identity, 97% coverage: 6:326/330 of query aligns to 11:356/362 of O14104
- S81 (≠ E71) modified: Phosphoserine
- S91 (vs. gap) modified: Phosphoserine
3ty3A Crystal structure of homoisocitrate dehydrogenase from schizosaccharomyces pombe bound to glycyl-glycyl-glycine (see paper)
43% identity, 97% coverage: 6:326/330 of query aligns to 7:352/358 of 3ty3A
- active site: Y129 (= Y119), K192 (= K170), D228 (= D203), D252 (= D227), D256 (= D231)
- binding glycylglycylglycine: A74 (= A68), V75 (≠ A69), S77 (≠ E71), R93 (= R81), E281 (= E256), P282 (= P257), H284 (= H259)
P40495 Homoisocitrate dehydrogenase, mitochondrial; HIcDH; EC 1.1.1.87 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
44% identity, 99% coverage: 4:330/330 of query aligns to 26:371/371 of P40495
- Y150 (= Y119) mutation to F: Strongly reduced enzyme activity.
- K206 (= K170) mutation to M: Strongly reduced enzyme activity.
6m3sB Dimeric isocitrate dehydrogenase from xanthomonas campestris pv. Campestris 8004
43% identity, 100% coverage: 2:330/330 of query aligns to 6:338/338 of 6m3sB
- active site: Y128 (= Y119), K177 (= K170), D210 (= D203), D234 (= D227)
- binding isocitrate calcium complex: T75 (≠ G67), S83 (≠ D75), N85 (≠ I77), R89 (= R81), R99 (= R91), R121 (= R112), Y128 (= Y119), D234 (= D227), D238 (= D231)
- binding nicotinamide-adenine-dinucleotide: P72 (vs. gap), L73 (= L65), T75 (≠ G67), N85 (≠ I77), H266 (= H259), G267 (= G260), S268 (= S261), A269 (= A262), D271 (= D264), I272 (= I265), N279 (= N272)
2d1cA Crystal structure of tt0538 protein from thermus thermophilus hb8
43% identity, 92% coverage: 4:307/330 of query aligns to 21:327/495 of 2d1cA
- active site: Y143 (= Y119), K190 (= K170), D223 (= D203), D247 (= D227), D251 (= D231)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P86 (≠ A68), L87 (≠ A69), E88 (vs. gap), T89 (vs. gap), N99 (≠ D75), I221 (≠ Y201), N224 (≠ A204), Q228 (≠ Y208), L260 (= L240), G261 (= G241), H279 (= H259), G280 (= G260), S281 (= S261), A282 (= A262), K284 (≠ D264), Y285 (≠ I265), I291 (≠ A271), N292 (= N272)
Sites not aligning to the query:
8grdA Crystal structure of a constitutively active mutant of the alpha beta heterodimer of human idh3 in complex with adp and mg (see paper)
38% identity, 100% coverage: 1:330/330 of query aligns to 1:323/325 of 8grdA
5hn6A Crystal structure of beta-decarboxylating dehydrogenase (tk0280) from thermococcus kodakarensis complexed with mn and 3-isopropylmalate (see paper)
42% identity, 98% coverage: 1:322/330 of query aligns to 1:311/329 of 5hn6A
5hn4A Crystal structure of beta-decarboxylating dehydrogenase (tk0280) from thermococcus kodakarensis complexed with mn and homoisocitrate (see paper)
42% identity, 98% coverage: 1:322/330 of query aligns to 1:311/329 of 5hn4A
- active site: Y118 (= Y119), K163 (= K170), D194 (= D203), D218 (= D227), D222 (= D231)
- binding (1R,2S)-1-hydroxybutane-1,2,4-tricarboxylic acid: T71 (= T72), S80 (vs. gap), R86 (= R81), R96 (= R91), R111 (= R112), Y118 (= Y119), D218 (= D227)
5greA Crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+), citrate and adp (see paper)
38% identity, 100% coverage: 1:330/330 of query aligns to 1:322/325 of 5greA
Q9D6R2 Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; Isocitric dehydrogenase subunit alpha; NAD(+)-specific ICDH subunit alpha; EC 1.1.1.41 from Mus musculus (Mouse) (see paper)
38% identity, 100% coverage: 1:330/330 of query aligns to 31:362/366 of Q9D6R2
- E229 (≠ D199) mutation to K: Homozygous mutant mice exhibit retinal degeneration.
6xxyA Crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. (see paper)
39% identity, 100% coverage: 2:330/330 of query aligns to 4:358/358 of 6xxyA
- active site: Y144 (= Y119), K194 (= K170), D226 (= D203), D250 (= D227)
- binding magnesium ion: D250 (= D227), D254 (= D231)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ A68), V75 (≠ A69), G76 (= G70), E90 (≠ A73), L94 (≠ I77), Y224 (= Y201), N227 (≠ A204), M230 (= M207), M263 (≠ L240), G264 (= G241), E280 (= E256), G283 (≠ H259), G284 (= G260), S285 (= S261), A286 (= A262), P287 (= P263), D288 (= D264), I289 (= I265), N296 (= N272), D337 (= D312)
- binding 2-(2-methylprop-2-enoxyamino)-2-oxidanylidene-ethanoic acid: E90 (≠ A73), R108 (= R91), R137 (= R112), K194 (= K170), V197 (= V173), D226 (= D203), D250 (= D227)
6l59A Crystal structure of the alpha gamma heterodimer of human idh3 in complex with cit, mg and atp binding at allosteric site and mg, atp binding at active site. (see paper)
38% identity, 100% coverage: 1:330/330 of query aligns to 1:321/325 of 6l59A
- active site: Y112 (= Y119), K159 (= K170), D192 (= D203), D216 (= D227)
- binding adenosine-5'-triphosphate: I12 (= I12), H249 (= H259), G250 (= G260), T251 (≠ S261), A252 (= A262), N262 (= N272), D303 (= D312)
- binding magnesium ion: D216 (= D227), D220 (= D231)
6kdeA Crystal structure of the alpha beta heterodimer of human idh3 in complex with ca(2+) (see paper)
38% identity, 100% coverage: 1:330/330 of query aligns to 2:333/336 of 6kdeA
6kdyA Crystal structure of the alpha bata heterodimer of human idh3 in complex with NAD. (see paper)
38% identity, 100% coverage: 1:330/330 of query aligns to 2:333/335 of 6kdyA
- active site: Y124 (= Y119), K171 (= K170), D204 (= D203), D228 (= D227)
- binding nicotinamide-adenine-dinucleotide: P69 (vs. gap), L70 (vs. gap), T72 (vs. gap), N82 (≠ D75), H261 (= H259), G262 (= G260), T263 (≠ S261), A264 (= A262), D266 (= D264), I267 (= I265), N274 (= N272), D315 (= D312)
Query Sequence
>WP_011868824.1 NCBI__GCF_000016125.1:WP_011868824.1
MHKICVIEGDGIGKEVVPAAVEVLKATGIEFEFNYALAGDEVFEKTGVALPEETINAAKT
ADAVLFGAAGETAADVIVKLRKILDTYANIRPVKSYNGINCLKTGIDYIIVRENTEGLYK
GIESEITEGVTVATRVITKEASERIFKHAFEMAKDRKSTGKEVKVTCAHKANVLKITDGL
FKKTFYEVSKDYEDIKTEDFYVDAMNMYIISRPETFDIVVTSNLFGDILSDGAVGMVGGL
GMAPSGNVGDDYGLFEPIHGSAPDIAGKGLANPTATILTAVMMLRYLKENGAADKVEKAL
EEVLSLGLTTPDLGGTLSTSEMGQEVAKRV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory