SitesBLAST
Comparing WP_011882427.1 NCBI__GCF_000016205.1:WP_011882427.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
49% identity, 93% coverage: 3:474/507 of query aligns to 12:485/514 of P04968
- K62 (= K53) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N80) binding
- GGGGL 188:192 (= GGGGL 179:183) binding
- S315 (= S305) binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
50% identity, 91% coverage: 3:465/507 of query aligns to 8:472/494 of 1tdjA
- active site: K58 (= K53), A83 (= A78), E209 (= E204), S213 (≠ A208), C215 (≠ S210), G237 (= G232), L310 (≠ A304), S311 (= S305)
- binding pyridoxal-5'-phosphate: F57 (= F52), K58 (= K53), N85 (= N80), G184 (= G179), G185 (= G180), G186 (= G181), G187 (= G182), G237 (= G232), E282 (= E277), S311 (= S305), G312 (= G306)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 59% coverage: 16:313/507 of query aligns to 20:316/323 of O59791
- S82 (≠ A78) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
32% identity, 59% coverage: 16:313/507 of query aligns to 15:311/318 of 1wtcA
- active site: K52 (= K53), S77 (≠ A78), E203 (= E204), G207 (≠ A208), D209 (≠ S210), G231 (= G232), I302 (≠ A304), S303 (= S305)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ V21), K47 (≠ P48), M48 (≠ S49), A109 (≠ Q110), A110 (= A111), Y114 (= Y115)
- binding magnesium ion: E203 (= E204), G207 (≠ A208), D209 (≠ S210)
- binding pyridoxal-5'-phosphate: F51 (= F52), K52 (= K53), N79 (= N80), G178 (= G179), G179 (= G180), G180 (= G181), G181 (= G182), G231 (= G232), E276 (= E277), T278 (≠ S279), S303 (= S305)
1v71A Crystal structure of s.Pombe serine racemase
32% identity, 59% coverage: 16:313/507 of query aligns to 15:311/318 of 1v71A
- active site: K52 (= K53), S77 (≠ A78), E203 (= E204), G207 (≠ A208), D209 (≠ S210), G231 (= G232), I302 (≠ A304), S303 (= S305)
- binding magnesium ion: E203 (= E204), G207 (≠ A208), D209 (≠ S210)
- binding pyridoxal-5'-phosphate: F51 (= F52), K52 (= K53), N79 (= N80), G178 (= G179), G179 (= G180), G180 (= G181), G181 (= G182), G231 (= G232), E276 (= E277), T278 (≠ S279), S303 (= S305), G304 (= G306)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
32% identity, 59% coverage: 16:313/507 of query aligns to 16:312/319 of 2zr8A
- active site: K53 (= K53), S78 (≠ A78), E204 (= E204), G208 (≠ A208), D210 (≠ S210), G232 (= G232), I303 (≠ A304), S304 (= S305)
- binding magnesium ion: E204 (= E204), G208 (≠ A208), D210 (≠ S210)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F52), K53 (= K53), S77 (= S77), S78 (≠ A78), N80 (= N80), H81 (= H81), P147 (= P147), G179 (= G179), G180 (= G180), G181 (= G181), G182 (= G182), G232 (= G232), E277 (= E277), T279 (≠ S279), S304 (= S305)
- binding serine: S78 (≠ A78), R129 (≠ C130), D231 (= D231), G232 (= G232), A233 (≠ V233), Q234 (≠ A234), T235 (≠ V235)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
32% identity, 59% coverage: 16:313/507 of query aligns to 16:312/319 of 2zpuA
- active site: K53 (= K53), S78 (≠ A78), E204 (= E204), G208 (≠ A208), D210 (≠ S210), G232 (= G232), I303 (≠ A304), S304 (= S305)
- binding magnesium ion: E204 (= E204), G208 (≠ A208), D210 (≠ S210)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F52), K53 (= K53), S77 (= S77), S78 (≠ A78), N80 (= N80), H81 (= H81), P147 (= P147), G179 (= G179), G180 (= G180), G181 (= G181), G182 (= G182), G232 (= G232), E277 (= E277), T279 (≠ S279), S304 (= S305)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
40% identity, 47% coverage: 22:261/507 of query aligns to 25:264/326 of 2gn2A
- active site: K56 (= K53), A81 (= A78), Q207 (≠ E204), V211 (≠ A208), G213 (≠ S210), G235 (= G232)
- binding cytidine-5'-monophosphate: R51 (≠ P48), T52 (≠ S49), G53 (≠ F50), A114 (= A111), D117 (≠ R114), Y118 (= Y115)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 57% coverage: 23:311/507 of query aligns to 23:316/322 of 7nbgAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E204), A211 (= A208), D213 (≠ S210), G236 (= G232), L309 (≠ A304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (= A208), D213 (≠ S210)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (= G232), V237 (= V233), T282 (≠ S279), S310 (= S305), G311 (= G306)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A78), G85 (≠ A82), Q86 (= Q83), I101 (≠ V98), K111 (= K108), I115 (≠ V112), Y118 (= Y115)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
33% identity, 57% coverage: 23:311/507 of query aligns to 23:316/320 of 7nbhAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E204), A211 (= A208), D213 (≠ S210), G236 (= G232), L309 (≠ A304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (= A208), D213 (≠ S210)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A78), G85 (≠ A82), Q86 (= Q83), K111 (= K108), I115 (≠ V112), Y118 (= Y115), D235 (= D231), P281 (= P278), N313 (= N308), V314 (≠ M309), D315 (≠ N310)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
33% identity, 57% coverage: 23:311/507 of query aligns to 23:316/323 of 7nbfAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E204), A211 (= A208), D213 (≠ S210), G236 (= G232), L309 (≠ A304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (= A208), D213 (≠ S210)
- binding magnesium ion: N244 (≠ Y241)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (= G232), V237 (= V233), T282 (≠ S279), S310 (= S305), G311 (= G306)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: T23 (= T23), P24 (= P24), L26 (≠ E26), T27 (≠ S27), F46 (≠ M46)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
33% identity, 57% coverage: 23:311/507 of query aligns to 23:316/323 of 7nbdAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E204), A211 (= A208), D213 (≠ S210), G236 (= G232), L309 (≠ A304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (= A208), D213 (≠ S210)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ F269), L278 (≠ I275), V314 (≠ M309), L316 (≠ F311)
- binding magnesium ion: N244 (≠ Y241)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (= G232), V237 (= V233), E280 (= E277), T282 (≠ S279), S310 (= S305), G311 (= G306)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 57% coverage: 23:311/507 of query aligns to 23:316/323 of 7nbcCCC
- active site: K53 (= K53), S81 (≠ A78), E207 (= E204), A211 (= A208), D213 (≠ S210), G236 (= G232), L309 (≠ A304), S310 (= S305)
- binding biphenyl-4-ylacetic acid: T78 (= T75), H79 (≠ A76), H84 (= H81), V148 (= V145), H149 (≠ P146), P150 (= P147)
- binding calcium ion: E207 (= E204), A211 (= A208), D213 (≠ S210)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (= G232), V237 (= V233), T282 (≠ S279), S310 (= S305), G311 (= G306)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 57% coverage: 23:311/507 of query aligns to 23:316/323 of 7nbcAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (= E204), A211 (= A208), D213 (≠ S210), G236 (= G232), L309 (≠ A304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (= A208), D213 (≠ S210)
- binding magnesium ion: N244 (≠ Y241)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G179), G183 (= G180), G184 (= G181), G185 (= G182), M186 (≠ L183), G236 (= G232), V237 (= V233), T282 (≠ S279), S310 (= S305), G311 (= G306)
Sites not aligning to the query:
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
32% identity, 58% coverage: 20:313/507 of query aligns to 20:312/319 of A4F2N8
- K53 (= K53) mutation to A: Loss of enzymatic activity.
6zspAAA serine racemase bound to atp and malonate. (see paper)
33% identity, 57% coverage: 23:311/507 of query aligns to 23:309/320 of 6zspAAA
- active site: K53 (= K53), S74 (≠ A78), E200 (= E204), A204 (= A208), D206 (≠ S210), G229 (= G232), L302 (≠ A304), S303 (= S305)
- binding adenosine-5'-triphosphate: S28 (≠ L28), S29 (= S29), I30 (≠ R30), K48 (≠ P48), T49 (≠ S49), Q79 (= Q83), Y111 (= Y115), E266 (≠ V270), R267 (≠ D271), K269 (≠ R273), N306 (= N308)
- binding magnesium ion: E200 (= E204), A204 (= A208), D206 (≠ S210)
- binding malonate ion: K53 (= K53), S73 (= S77), S74 (≠ A78), N76 (= N80), H77 (= H81), R125 (≠ A129), G229 (= G232), S232 (≠ R236)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
33% identity, 57% coverage: 23:311/507 of query aligns to 24:312/322 of 3l6bA
- active site: K54 (= K53), S77 (≠ A78), E203 (= E204), A207 (= A208), D209 (≠ S210), G232 (= G232), T278 (≠ S279), L305 (≠ A304), S306 (= S305)
- binding malonate ion: K54 (= K53), S76 (= S77), S77 (≠ A78), N79 (= N80), H80 (= H81), R128 (≠ A129), G232 (= G232)
- binding manganese (ii) ion: E203 (= E204), A207 (= A208), D209 (≠ S210)
- binding pyridoxal-5'-phosphate: F53 (= F52), K54 (= K53), N79 (= N80), G178 (= G179), G179 (= G180), G180 (= G181), G181 (= G182), M182 (≠ L183), V233 (= V233), E276 (= E277), T278 (≠ S279), S306 (= S305), G307 (= G306)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 57% coverage: 23:310/507 of query aligns to 23:310/310 of 7nbgDDD
- active site: K53 (= K53), S76 (≠ A78), E202 (= E204), A206 (= A208), D208 (≠ S210), G231 (= G232), L304 (≠ A304), S305 (= S305)
- binding calcium ion: E202 (= E204), A206 (= A208), D208 (≠ S210)
- binding magnesium ion: N239 (≠ Y241)
- binding ortho-xylene: S76 (≠ A78), Q81 (= Q83), I96 (≠ V98), Y113 (= Y115)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N78 (= N80), G177 (= G179), G178 (= G180), G179 (= G181), G180 (= G182), M181 (≠ L183), G231 (= G232), V232 (= V233), E275 (= E277), T277 (≠ S279), S305 (= S305), G306 (= G306)
Sites not aligning to the query:
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
32% identity, 58% coverage: 22:314/507 of query aligns to 37:332/339 of Q7XSN8
- E219 (= E204) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ S210) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
39% identity, 53% coverage: 44:312/507 of query aligns to 41:307/308 of 1ve5A
- active site: K50 (= K53), S56 (≠ A62), S72 (≠ A78), E200 (= E204), A204 (= A208), D206 (≠ S210), G229 (= G232), L299 (≠ A304), S300 (= S305)
- binding calcium ion: E200 (= E204), A204 (= A208), D206 (≠ S210)
- binding pyridoxal-5'-phosphate: F49 (= F52), K50 (= K53), N74 (= N80), G175 (= G179), G176 (= G180), G177 (= G181), G178 (= G182), E274 (= E277), T276 (≠ S279), S300 (= S305), G301 (= G306)
Query Sequence
>WP_011882427.1 NCBI__GCF_000016205.1:WP_011882427.1
MHEDFNYLTSILNAPVYDVAVKTPLESLSRLSERLGSRVLLKREDMQPSFSFKVRGAYTL
MARLSAEALARGVVTASAGNHAQGVALAAHTLGCRARVFMPHTTPDIKVQAVARYGAEVV
LYGDNFDDACDAALADARERDSTFVPPFDHPHVIAGQGTVGMEILQQTTQLDAIFVPIGG
GGLAAGICAYVKRVKPQIRIFGVEPSDADSMYQALEGGAPVRLAHVGRFCDGVAVRQVGA
YSFALCRQYLDGVVRVDNDEVCAAIKDVFVDTRSILEPSGALALAGLKAWQRREQKGGTL
VAIASGANMNFDQLRYIAERSTLGENREARFAVSIAERPGSFRALIEQLGDCVVTAFDYR
RATGGDAQVFVGVRTPGAEGARKIVQDLAAAGYRATDLGGSTLWRTHGHQLVGAEAFRID
DEKLFQVMFPERRGALLEFLRKLDDAWDISLFHYRNEGFDYGRVLIGIRCGEADSARLYG
ALEATNFEFSEQADASPYLASLQGERR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory