Comparing WP_011913202.1 NCBI__GCF_000013785.1:WP_011913202.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96255 Phosphoserine aminotransferase 1, chloroplastic; AtPSAT1; Phosphohydroxythreonine aminotransferase; EC 2.6.1.52 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 57% coverage: 12:286/485 of query aligns to 74:349/430 of Q96255
6czyA Crystal structure of arabidopsis thaliana phosphoserine aminotransferase isoform 1 (atpsat1) in complex with pyridoxamine-5'- phosphate (pmp) (see paper)
40% identity, 57% coverage: 9:286/485 of query aligns to 3:281/362 of 6czyA
6czzA Crystal structure of arabidopsis thaliana phosphoserine aminotransferase isoform 1 (atpsat1) in complex with plp- phosphoserine geminal diamine intermediate (see paper)
40% identity, 57% coverage: 9:286/485 of query aligns to 1:279/360 of 6czzA
Sites not aligning to the query:
3qboB Crystal structure of phosphoserine aminotransferase from yersinia pestis co92
44% identity, 57% coverage: 12:288/485 of query aligns to 3:288/359 of 3qboB
7t7jB Crystal structure of phosphoserine aminotransferase from klebsiella pneumoniae subsp. Pneumoniae in complex with pyridoxal phosphate
43% identity, 57% coverage: 12:289/485 of query aligns to 3:290/360 of 7t7jB
1bt4A Phosphoserine aminotransferase from bacillus circulans subsp. Alkalophilus
41% identity, 59% coverage: 12:296/485 of query aligns to 5:287/361 of 1bt4A
1bjoA The structure of phosphoserine aminotransferase from e. Coli in complex with alpha-methyl-l-glutamate (see paper)
41% identity, 57% coverage: 12:289/485 of query aligns to 3:290/360 of 1bjoA
6xdkD Crystal structure of phosphoserine aminotransferase (serc) from stenotrophomonas maltophilia k279a
47% identity, 53% coverage: 12:266/485 of query aligns to 3:258/359 of 6xdkD
8a5wC Crystal structure of the human phosphoserine aminotransferase (psat) in complex with o-phosphoserine (see paper)
41% identity, 56% coverage: 13:282/485 of query aligns to 4:275/365 of 8a5wC
Sites not aligning to the query:
8a5wA Crystal structure of the human phosphoserine aminotransferase (psat) in complex with o-phosphoserine (see paper)
41% identity, 56% coverage: 13:282/485 of query aligns to 4:275/365 of 8a5wA
Sites not aligning to the query:
8a5vA Crystal structure of the human phosposerine aminotransferase (psat) (see paper)
41% identity, 56% coverage: 13:282/485 of query aligns to 4:275/365 of 8a5vA
8a5vE Crystal structure of the human phosposerine aminotransferase (psat) (see paper)
41% identity, 56% coverage: 13:282/485 of query aligns to 5:276/366 of 8a5vE
Sites not aligning to the query:
Q9Y617 Phosphoserine aminotransferase; Phosphohydroxythreonine aminotransferase; PSAT; EC 2.6.1.52 from Homo sapiens (Human) (see 6 papers)
41% identity, 56% coverage: 13:282/485 of query aligns to 9:280/370 of Q9Y617
Sites not aligning to the query:
6xdkB Crystal structure of phosphoserine aminotransferase (serc) from stenotrophomonas maltophilia k279a
46% identity, 53% coverage: 12:266/485 of query aligns to 3:254/355 of 6xdkB
8a5wE Crystal structure of the human phosphoserine aminotransferase (psat) in complex with o-phosphoserine (see paper)
41% identity, 56% coverage: 13:282/485 of query aligns to 5:275/365 of 8a5wE
Sites not aligning to the query:
4azjA Structural basis of l-phosphoserine binding to bacillus alcalophilus phosphoserine aminotransferase (see paper)
36% identity, 64% coverage: 12:321/485 of query aligns to 5:316/360 of 4azjA
Sites not aligning to the query:
3e77A Human phosphoserine aminotransferase in complex with plp
40% identity, 54% coverage: 19:282/485 of query aligns to 8:273/363 of 3e77A
1w23B Crystal structure of phosphoserine aminotransferase from bacillus alcalophilus (see paper)
36% identity, 64% coverage: 12:321/485 of query aligns to 5:313/357 of 1w23B
5yb0B Crystal structure of wild type phosphoserine aminotransferase (psat) from e. Histolytica (see paper)
37% identity, 56% coverage: 12:281/485 of query aligns to 2:265/349 of 5yb0B
3qm2B 2.25 angstrom crystal structure of phosphoserine aminotransferase (serc) from salmonella enterica subsp. Enterica serovar typhimurium
37% identity, 57% coverage: 12:289/485 of query aligns to 3:261/331 of 3qm2B
>WP_011913202.1 NCBI__GCF_000013785.1:WP_011913202.1
MVCTCTEFAERYNFAAGPAMLPAEVLTQIREEMPDWRGSGSSILEQPFTSAAFKGLMEEV
EADLRTLLSIPRSYRVLFLQGGASAQFGLLPLNMLHPGQSADYLESGHWARRAISEARRH
ARVNVIASAAAQSFTALPSFEQWRPSPDAGYCHITSNETGNGLQLRDFPQLAVPLVADMT
SDFLTRPIPVERFGLIYASAQKNLGIAGLCVVIVHQNLLRRPPRHLPAAFSYAVQAEQQS
RFNTPPTFALYVAGLMLRWIRQNGGLPAMDEAAQRRSRELYRYANEVAQLGVMHNGAARL
GISLTLDARQASAESRAMLRAAWPHADYLMLNLIGPTSAPLLSQSTRLRHLLAALVDEQR
QLNQDGRRRVPLLAKLRCMPERTPFSIAGLLVELGFDGLLAAHDPGPPATAERYRAWQDP
RRQAHACQQIEDLRRFCGPDMALLSVGGVQTADHLRARMSAGAELVQVHTAFMHQSPWLA
RRLLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory