SitesBLAST
Comparing WP_011938718.1 NCBI__GCF_000016745.1:WP_011938718.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q48255 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
50% identity, 97% coverage: 1:140/144 of query aligns to 1:143/167 of Q48255
- N76 (= N73) binding
- H82 (= H79) binding
- D89 (= D86) binding
- R113 (= R110) binding
4b6rA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
50% identity, 97% coverage: 1:140/144 of query aligns to 1:143/157 of 4b6rA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N73), A79 (= A76), E100 (= E97), H102 (= H99), R109 (= R106)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: Y22 (= Y22), N76 (= N73), G78 (≠ A75), A79 (= A76), H82 (= H79), D89 (= D86), L93 (≠ A90), H102 (= H99), L103 (= L100), T104 (≠ S101), R113 (= R110)
4b6sA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
50% identity, 97% coverage: 1:140/144 of query aligns to 1:143/158 of 4b6sA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N73), A79 (= A76), E100 (= E97), H102 (= H99), R109 (= R106)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N10), L14 (= L14), Y22 (= Y22), N76 (= N73), G78 (≠ A75), A79 (= A76), H82 (= H79), H102 (= H99), L103 (= L100), T104 (≠ S101), R113 (= R110)
2xb9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3-dehydroquinic acid (see paper)
50% identity, 97% coverage: 1:140/144 of query aligns to 1:143/158 of 2xb9A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N73), A79 (= A76), E100 (= E97), H102 (= H99), R109 (= R106)
- binding (1r,2r,4s,5r)-1,4,5-trihydroxy-2-(4-methoxybenzyl)-3-oxocyclohexanecarboxylic acid: N10 (= N10), Y22 (= Y22), N76 (= N73), A79 (= A76), H82 (= H79), H102 (= H99), L103 (= L100), T104 (≠ S101), R113 (= R110)
1j2yA Crystal structure of the type ii 3-dehydroquinase (see paper)
50% identity, 97% coverage: 1:140/144 of query aligns to 1:143/158 of 1j2yA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N73), A79 (= A76), E100 (= E97), H102 (= H99), R109 (= R106)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: Y22 (= Y22), N76 (= N73), G78 (≠ A75), H82 (= H79), H102 (= H99), L103 (= L100), T104 (≠ S101), R113 (= R110)
2xd9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
50% identity, 97% coverage: 1:140/144 of query aligns to 1:143/153 of 2xd9A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N73), A79 (= A76), E100 (= E97), H102 (= H99), R109 (= R106)
- binding (4r,6r,7s)-4,6,7-trihydroxy-2-[(1e)-prop-1-en-1-yl]-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N10), L14 (= L14), Y22 (= Y22), N76 (= N73), G78 (≠ A75), A79 (= A76), H82 (= H79), H102 (= H99), L103 (= L100), T104 (≠ S101), R113 (= R110)
2wksA Structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor. (see paper)
50% identity, 97% coverage: 1:140/144 of query aligns to 1:143/153 of 2wksA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N73), A79 (= A76), E100 (= E97), H102 (= H99), R109 (= R106)
- binding (1R,4S,5R)-1,4,5-trihydroxy-3-[(5-methyl-1-benzothiophen-2-yl)methoxy]cyclohex-2-ene-1-carboxylic acid: L11 (= L11), Y22 (= Y22), N76 (= N73), G78 (≠ A75), A79 (= A76), H82 (= H79), H102 (= H99), L103 (= L100), T104 (≠ S101), R113 (= R110)
2xdaA Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-2-(2-cyclopropyl)ethyl-4,6,7- trihydroxy-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
50% identity, 97% coverage: 1:140/144 of query aligns to 1:143/150 of 2xdaA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N76 (= N73), A79 (= A76), E100 (= E97), H102 (= H99), R109 (= R106)
- binding (4r,6r,7s)-2-(2-cyclopropylethyl)-4,6,7-trihydroxy-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N10), L11 (= L11), M13 (= M13), Y22 (= Y22), N76 (= N73), A79 (= A76), H82 (= H79), H102 (= H99), L103 (= L100), T104 (≠ S101), R113 (= R110)
2c4wA Type ii dehydroquinase from h. Pylori in complex with ah9095 (see paper)
50% identity, 97% coverage: 1:140/144 of query aligns to 10:152/168 of 2c4wA
- active site: P18 (= P9), N19 (= N10), R26 (= R17), Y31 (= Y22), N85 (= N73), A88 (= A76), E109 (= E97), H111 (= H99), R118 (= R106)
- binding n-tetrazol-5-yl 9-oxo-9h-xanthene-2 sulphonamide: L20 (= L11), L23 (= L14), D27 (≠ E18), G87 (≠ A75), H91 (= H79), H111 (= H99), L112 (= L100), T113 (≠ S101), I115 (= I103), R122 (= R110)
5ydbA Crystal structure of the complex of type ii dehydroquinate dehydratase from acinetobacter baumannii with dehydroquinic acid at 1.76 angstrom resolution
54% identity, 92% coverage: 3:135/144 of query aligns to 3:136/145 of 5ydbA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N74 (= N73), A77 (= A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: N74 (= N73), A76 (= A75), A77 (= A76), H80 (= H79), H100 (= H99), L101 (= L100), S102 (= S101), R111 (= R110)
5b6pB Structure of the dodecameric type-ii dehydrogenate dehydratase from acinetobacter baumannii at 2.00 a resolution (see paper)
54% identity, 92% coverage: 3:135/144 of query aligns to 3:136/145 of 5b6pB
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N74 (= N73), A77 (= A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding sulfate ion: N74 (= N73), H100 (= H99), L101 (= L100), S102 (= S101)
8idrC Crystal structure of apo-form of dehydroquinate dehydratase from corynebacterium glutamicum (see paper)
49% identity, 99% coverage: 2:143/144 of query aligns to 3:144/147 of 8idrC
3n76A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with compound 5 (see paper)
47% identity, 95% coverage: 5:141/144 of query aligns to 6:142/143 of 3n76A
- active site: P10 (= P9), N11 (= N10), R18 (= R17), Y23 (= Y22), N74 (= N73), G77 (≠ A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: N11 (= N10), R14 (≠ M13), R18 (= R17), Y23 (= Y22), N74 (= N73), G76 (≠ A75), G77 (≠ A76), H80 (= H79), H100 (= H99), I101 (≠ L100), S102 (= S101), R111 (= R110)
4b6oA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
47% identity, 95% coverage: 5:141/144 of query aligns to 6:142/142 of 4b6oA
- active site: P10 (= P9), N11 (= N10), R18 (= R17), Y23 (= Y22), N74 (= N73), G77 (≠ A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N11 (= N10), N74 (= N73), G76 (≠ A75), G77 (≠ A76), H80 (= H79), H100 (= H99), I101 (≠ L100), S102 (= S101), R111 (= R110)
3n59C Type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate (see paper)
47% identity, 95% coverage: 5:141/144 of query aligns to 6:142/142 of 3n59C
- active site: P10 (= P9), N11 (= N10), R18 (= R17), N74 (= N73), G77 (≠ A76), E98 (= E97), H100 (= H99), R107 (= R106)
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: R18 (= R17), Y23 (= Y22), G76 (≠ A75), G77 (≠ A76), H80 (= H79), H100 (= H99), I101 (≠ L100), S102 (= S101), R111 (= R110)
4kiwA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49e [5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid] (see paper)
47% identity, 95% coverage: 5:141/144 of query aligns to 5:141/141 of 4kiwA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding 5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid: N10 (= N10), L11 (= L11), R13 (≠ M13), L14 (= L14), Y22 (= Y22), N73 (= N73), G75 (≠ A75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), V103 (≠ I103), R110 (= R110)
4kiuA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49d [5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid] (see paper)
47% identity, 95% coverage: 5:141/144 of query aligns to 5:141/141 of 4kiuA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding 5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid: N10 (= N10), R13 (≠ M13), L14 (= L14), E18 (= E18), Y22 (= Y22), G75 (≠ A75), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), R110 (= R110)
4ciwA Crystal structure of mycobacterium tuberculosis type 2 dehydroquinase in complex with (1r,4r,5r)-1,4,5-trihydroxy-3-(2-hydroxy) ethylcyclohex-2-ene-1-carboxylic acid (see paper)
47% identity, 95% coverage: 5:141/144 of query aligns to 5:141/141 of 4ciwA
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-(2-hydroxy)ethylcyclohex-2-ene-1-carboxylic acid: Y22 (= Y22), N73 (= N73), G75 (≠ A75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), R110 (= R110)
3n87A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 3 (see paper)
47% identity, 95% coverage: 5:141/144 of query aligns to 5:141/141 of 3n87A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,4R,5R)-1,4,5-trihydroxy-3-[3-(phenylcarbonyl)phenyl]cyclohex-2-ene-1-carboxylic acid: N10 (= N10), Y22 (= Y22), N73 (= N73), G75 (≠ A75), G76 (≠ A76), H79 (= H79), H99 (= H99), I100 (≠ L100), S101 (= S101), R110 (= R110)
3n86A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 4 (see paper)
47% identity, 95% coverage: 5:141/144 of query aligns to 5:141/141 of 3n86A
- active site: P9 (= P9), N10 (= N10), R17 (= R17), Y22 (= Y22), N73 (= N73), G76 (≠ A76), E97 (= E97), H99 (= H99), R106 (= R106)
- binding (1R,5R)-1,5-dihydroxy-4-oxo-3-[3-oxo-3-(phenylamino)propyl]cyclohex-2-ene-1-carboxylic acid: N10 (= N10), R13 (≠ M13), E18 (= E18), Y22 (= Y22), N73 (= N73), G75 (≠ A75), G76 (≠ A76), H79 (= H79), D86 (= D86), E90 (≠ A90), H99 (= H99), I100 (≠ L100), S101 (= S101), R110 (= R110)
Query Sequence
>WP_011938718.1 NCBI__GCF_000016745.1:WP_011938718.1
MKILVLHGPNLNMLGTREPEVYGKMTLDDIDSTLKELACELGVELTIYQSNSEGALVDKI
QSAVGSFDGILINPAAYTHTSVAIRDAIAATALPTVEVHLSNIHSREEFRTKSFVAPIAL
GQISGFGADSYLLGLRALFNHNKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory