Comparing WP_011939353.1 NCBI__GCF_000016745.1:WP_011939353.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
5j6fA Crystal structure of dah7ps-cm complex from geobacillus sp. With prephenate (see paper)
32% identity, 89% coverage: 3:83/91 of query aligns to 4:84/352 of 5j6fA
Sites not aligning to the query:
5gmuB Crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with chlorogenic acid (see paper)
29% identity, 86% coverage: 6:83/91 of query aligns to 8:85/87 of 5gmuB
P39912 Protein AroA(G); EC 2.5.1.54; EC 5.4.99.5 from Bacillus subtilis (strain 168) (see paper)
29% identity, 86% coverage: 6:83/91 of query aligns to 9:86/358 of P39912
Sites not aligning to the query:
6al9B Crystal structure of chorismate mutase from helicobacter pylori in complex with prephenate
35% identity, 89% coverage: 3:83/91 of query aligns to 5:83/91 of 6al9B
6al9A Crystal structure of chorismate mutase from helicobacter pylori in complex with prephenate
35% identity, 89% coverage: 3:83/91 of query aligns to 4:82/90 of 6al9A
3nvtA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e (see paper)
33% identity, 86% coverage: 6:83/91 of query aligns to 2:74/345 of 3nvtA
Sites not aligning to the query:
3tfcA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e in complex with phosphoenolpyruvate (see paper)
33% identity, 86% coverage: 6:83/91 of query aligns to 1:73/343 of 3tfcA
Sites not aligning to the query:
2gtvX Nmr structure of monomeric chorismate mutase from methanococcus jannaschii (see paper)
31% identity, 87% coverage: 6:84/91 of query aligns to 8:95/104 of 2gtvX
5ckxD Non-covalent complex of dahp synthase and chorismate mutase from mycobacterium tuberculosis with bound transition state analog and feedback effectors tyrosine and phenylalanine (see paper)
38% identity, 64% coverage: 3:60/91 of query aligns to 3:60/79 of 5ckxD
Sites not aligning to the query:
>WP_011939353.1 NCBI__GCF_000016745.1:WP_011939353.1
MNIDNLREQIDNLDSELLRIFNERANLALKIGEIKKGLALPVYDPSREKKIFKRMQEENP
GPLDDQAIVRLFERVIDESRRLERIMTSREL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory