SitesBLAST
Comparing WP_011952099.1 NCBI__GCF_000016765.1:WP_011952099.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
40% identity, 97% coverage: 5:408/417 of query aligns to 13:417/429 of 6ed7A
- active site: Y17 (≠ F9), Y144 (= Y136), D245 (= D230), K274 (= K259)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ F9), W52 (= W44), W52 (= W44), Y144 (= Y136), D147 (= D139), A217 (= A202), K274 (= K259), R391 (= R382), F393 (≠ M384), F393 (≠ M384)
- binding pyridoxal-5'-phosphate: G112 (= G104), S113 (= S105), Y144 (= Y136), H145 (= H137), D245 (= D230), I247 (≠ V232), K274 (= K259)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
40% identity, 97% coverage: 5:408/417 of query aligns to 13:417/429 of P12995
- Y17 (≠ F9) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W44) binding
- GS 112:113 (= GS 104:105) binding
- Y144 (= Y136) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D139) mutation to N: Loss of aminotransferase activity.
- D245 (= D230) binding
- R253 (= R238) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K259) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (≠ S293) binding
- PT 308:309 (≠ SS 294:295) binding
- R391 (= R382) binding ; mutation to A: Reduces aminotransferase activity.
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
40% identity, 97% coverage: 5:408/417 of query aligns to 13:416/427 of 1mlzA
- active site: Y17 (≠ F9), Y144 (= Y136), E210 (= E196), D244 (= D230), A247 (≠ M233), K273 (= K259), Y397 (= Y389)
- binding pyridoxal-5'-phosphate: G112 (= G104), S113 (= S105), Y144 (= Y136), H145 (= H137), D244 (= D230), I246 (≠ V232), K273 (= K259), P307 (≠ S294), T308 (≠ S295)
- binding trans-amiclenomycin: W52 (= W44), W53 (= W45), Y144 (= Y136), K273 (= K259), R390 (= R382), F392 (≠ M384)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
40% identity, 97% coverage: 5:408/417 of query aligns to 13:416/427 of 1mlyA
- active site: Y17 (≠ F9), Y144 (= Y136), E210 (= E196), D244 (= D230), A247 (≠ M233), K273 (= K259), Y397 (= Y389)
- binding cis-amiclenomycin: W52 (= W44), W53 (= W45), K273 (= K259), R390 (= R382), F392 (≠ M384)
- binding pyridoxal-5'-phosphate: G112 (= G104), S113 (= S105), Y144 (= Y136), H145 (= H137), D244 (= D230), I246 (≠ V232), K273 (= K259), P307 (≠ S294), T308 (≠ S295)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
39% identity, 97% coverage: 5:408/417 of query aligns to 13:417/429 of 1dtyA
- active site: Y17 (≠ F9), Y144 (= Y136), E211 (= E196), D245 (= D230), A248 (≠ M233), K274 (= K259), Y398 (= Y389)
- binding pyridoxal-5'-phosphate: G112 (= G104), S113 (= S105), Y144 (= Y136), H145 (= H137), D245 (= D230), I247 (≠ V232), K274 (= K259)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
36% identity, 98% coverage: 5:413/417 of query aligns to 13:440/448 of 3du4A
- active site: F17 (= F9), Y146 (= Y136), E217 (= E196), D251 (= D230), A254 (≠ M233), K280 (= K259), A417 (≠ Y389)
- binding 7-keto-8-aminopelargonic acid: L82 (≠ A73), Y146 (= Y136), G315 (≠ S293), S317 (= S295), R410 (= R382)
- binding pyridoxal-5'-phosphate: S112 (= S103), G113 (= G104), A114 (≠ S105), Y146 (= Y136), H147 (= H137), E217 (= E196), D251 (= D230), V253 (= V232), A254 (≠ M233), K280 (= K259), H316 (≠ S294), S317 (= S295)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
36% identity, 98% coverage: 5:413/417 of query aligns to 13:440/448 of P53555
- GA 113:114 (≠ GS 104:105) binding
- Y146 (= Y136) binding
- K280 (= K259) modified: N6-(pyridoxal phosphate)lysine
- G315 (≠ S293) binding
- HS 316:317 (≠ SS 294:295) binding
- R410 (= R382) binding
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
39% identity, 97% coverage: 5:408/417 of query aligns to 13:405/416 of 1qj3A
- active site: Y17 (≠ F9), Y144 (= Y136), E201 (= E196), D235 (= D230), A238 (≠ M233), K264 (= K259), Y386 (= Y389)
- binding 7-keto-8-aminopelargonic acid: Y17 (≠ F9), W52 (= W44), Y144 (= Y136), K264 (= K259), R379 (= R382), F381 (≠ M384)
- binding pyridoxal-5'-phosphate: G112 (= G104), S113 (= S105), Y144 (= Y136), H145 (= H137), G146 (= G138), D235 (= D230), I237 (≠ V232), A238 (≠ M233), K264 (= K259)
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
35% identity, 98% coverage: 5:413/417 of query aligns to 13:438/438 of 6zhkA
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
37% identity, 97% coverage: 5:409/417 of query aligns to 14:410/420 of 6erkA
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
40% identity, 98% coverage: 5:412/417 of query aligns to 14:422/427 of 4cxqA
- active site: Y18 (≠ F9), Y149 (= Y136), E212 (= E196), D246 (= D230), A249 (≠ M233), K275 (= K259), Y399 (= Y389)
- binding 7-keto-8-aminopelargonic acid: W56 (= W44), Y149 (= Y136), G308 (≠ S293), T310 (≠ S295), R392 (= R382)
- binding pyridoxal-5'-phosphate: G116 (= G104), S117 (= S105), Y149 (= Y136), H150 (= H137), G151 (= G138), E212 (= E196), D246 (= D230), I248 (≠ V232), K275 (= K259), P309 (≠ S294), T310 (≠ S295)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
40% identity, 98% coverage: 5:412/417 of query aligns to 14:420/425 of 4w1vA
- active site: Y18 (≠ F9), Y147 (= Y136), E210 (= E196), D244 (= D230), A247 (≠ M233), K273 (= K259), Y397 (= Y389)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P8), Y18 (≠ F9), W54 (= W44), M81 (≠ I71), G83 (≠ A73), Y147 (= Y136), G306 (≠ S293), P307 (≠ S294), T308 (≠ S295), F392 (≠ M384)
- binding pyridoxal-5'-phosphate: G114 (= G104), S115 (= S105), Y147 (= Y136), H148 (= H137), E210 (= E196), D244 (= D230), I246 (≠ V232), K273 (= K259)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
40% identity, 98% coverage: 5:412/417 of query aligns to 14:420/425 of 4cxrA
- active site: Y18 (≠ F9), Y147 (= Y136), E210 (= E196), D244 (= D230), A247 (≠ M233), K273 (= K259), Y397 (= Y389)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ F9), W54 (= W44), W55 (= W45), A216 (= A202)
- binding pyridoxal-5'-phosphate: G114 (= G104), S115 (= S105), Y147 (= Y136), H148 (= H137), E210 (= E196), D244 (= D230), I246 (≠ V232), K273 (= K259), P307 (≠ S294), T308 (≠ S295)
3tfuA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, post-reaction complex with a 3,6- dihydropyrid-2-one heterocycle inhibitor (see paper)
40% identity, 98% coverage: 5:412/417 of query aligns to 15:414/417 of 3tfuA
- active site: Y19 (≠ F9), Y151 (= Y136), E204 (= E196), D238 (= D230), A241 (≠ M233), K267 (= K259), Y391 (= Y389)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-2-oxo-1,2-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: W58 (= W44), G118 (= G104), S119 (= S105), Y151 (= Y136), H152 (= H137), D238 (= D230), I240 (≠ V232), K267 (= K259), P301 (≠ S294), T302 (≠ S295)
5te2A Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a mechanism-based inhibitor (see paper)
41% identity, 90% coverage: 38:412/417 of query aligns to 51:423/428 of 5te2A
- active site: Y150 (= Y136), E213 (= E196), D247 (= D230), A250 (≠ M233), K276 (= K259), Y400 (= Y389)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-4-oxo-1,4-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: W57 (= W44), G117 (= G104), S118 (= S105), Y150 (= Y136), H151 (= H137), G152 (= G138), D247 (= D230), I249 (≠ V232), K276 (= K259), G309 (≠ S293), P310 (≠ S294), T311 (≠ S295)
Sites not aligning to the query:
4xjoA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
41% identity, 90% coverage: 38:412/417 of query aligns to 51:423/428 of 4xjoA
- active site: Y150 (= Y136), E213 (= E196), D247 (= D230), A250 (≠ M233), K276 (= K259), Y400 (= Y389)
- binding 5-[4-(3-chlorobenzoyl)piperazin-1-yl]-1H-inden-1-one: W57 (= W44), M84 (≠ I71), G86 (≠ A73), Y150 (= Y136), G165 (≠ R149), G166 (= G150), A219 (= A202), P310 (≠ S294), T311 (≠ S295)
- binding pyridoxal-5'-phosphate: G117 (= G104), S118 (= S105), Y150 (= Y136), H151 (= H137), G152 (= G138), E213 (= E196), D247 (= D230), I249 (≠ V232), K276 (= K259), P310 (≠ S294), T311 (≠ S295)
Sites not aligning to the query:
4xewA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound (see paper)
41% identity, 90% coverage: 38:412/417 of query aligns to 51:423/428 of 4xewA
- active site: Y150 (= Y136), E213 (= E196), D247 (= D230), A250 (≠ M233), K276 (= K259), Y400 (= Y389)
- binding 6-(2-fluorophenyl)[1,3]dioxolo[4,5-g]quinolin-8(5H)-one: W57 (= W44), Y150 (= Y136), P310 (≠ S294), T311 (≠ S295), R393 (= R382), F395 (≠ M384)
- binding pyridoxal-5'-phosphate: G117 (= G104), S118 (= S105), Y150 (= Y136), H151 (= H137), G152 (= G138), E213 (= E196), D247 (= D230), I249 (≠ V232), K276 (= K259), P310 (≠ S294), T311 (≠ S295)
Sites not aligning to the query:
4wyfA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a dsf fragment hit (see paper)
41% identity, 90% coverage: 38:412/417 of query aligns to 51:423/428 of 4wyfA
- active site: Y150 (= Y136), E213 (= E196), D247 (= D230), A250 (≠ M233), K276 (= K259), Y400 (= Y389)
- binding N-(1-oxo-1H-inden-5-yl)acetamide: M84 (≠ I71), G86 (≠ A73), G309 (≠ S293), P310 (≠ S294), T311 (≠ S295)
- binding pyridoxal-5'-phosphate: G117 (= G104), S118 (= S105), Y150 (= Y136), H151 (= H137), G152 (= G138), E213 (= E196), D247 (= D230), I249 (≠ V232), K276 (= K259), P310 (≠ S294), T311 (≠ S295)
Sites not aligning to the query:
4wycA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole benzamide inhibitor (see paper)
41% identity, 90% coverage: 38:412/417 of query aligns to 51:423/428 of 4wycA
- active site: Y150 (= Y136), E213 (= E196), D247 (= D230), A250 (≠ M233), K276 (= K259), Y400 (= Y389)
- binding 4-(1H-imidazol-1-yl)benzamide: W57 (= W44), M84 (≠ I71), G86 (≠ A73), Y150 (= Y136), G309 (≠ S293)
- binding pyridoxal-5'-phosphate: G117 (= G104), S118 (= S105), Y150 (= Y136), H151 (= H137), G152 (= G138), E213 (= E196), D247 (= D230), I249 (≠ V232), K276 (= K259), P310 (≠ S294), T311 (≠ S295)
Sites not aligning to the query:
4mqrA Mycobaterium tuberculosis transaminase bioa complexed with e)-5- hydroxy-4-(((z)-isonicotinoyldiazenyl)methylene)-6-methyl-1,4- dihydropyridin-3-yl)methyl phosphate (see paper)
41% identity, 90% coverage: 38:412/417 of query aligns to 51:423/428 of 4mqrA
- active site: Y150 (= Y136), E213 (= E196), D247 (= D230), A250 (≠ M233), K276 (= K259), Y400 (= Y389)
- binding [(4Z)-5-hydroxy-6-methyl-4-{[(E)-(pyridin-4-ylcarbonyl)diazenyl]methylidene}-1,4-dihydropyridin-3-yl]methyl dihydrogen phosphate: W57 (= W44), G117 (= G104), S118 (= S105), Y150 (= Y136), H151 (= H137), D247 (= D230), I249 (≠ V232), K276 (= K259), G309 (≠ S293), P310 (≠ S294), T311 (≠ S295)
Sites not aligning to the query:
Query Sequence
>WP_011952099.1 NCBI__GCF_000016765.1:WP_011952099.1
MSSPVWHPFTQHGLGEDIPLIERAEGAGLHAADGRRYVDAISSWWVTTHGHCNPRIMAAI
RAQTEKLDQLIFAGWTHGPAETLARALVDITPAGLDHVFFSDSGSTSVEVALKMALGTWL
NWGEPRHRIVVMEHSYHGDTIGAMSVGERGVYNRAYQPLLFDVDTLPFPVGDGDRTIAAL
EAICAQGTPPAALIVEPLILGAGGMLIYPPHVLKALRDICAREGVLFIADEVMTGWGRTG
MLFACQQAGVKPDLMCLSKGLTGGAIPLAATLATREIFDAHLSQDRARMFFHSSSYTANP
IACAAANANIAIWQEEPVLDRIGALVHRQARRLDRLDHPLIVGKRQLGTITAMEFVDPYG
DYLSAMAPMLGRFFRDNGLLLRPMGNTVYVMPPYCIDDKDLDAIYDAILAAALKMAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory