Comparing WP_011989220.1 NCBI__GCF_000016505.1:WP_011989220.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
37% identity, 97% coverage: 13:398/398 of query aligns to 1:380/380 of P54955
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
35% identity, 94% coverage: 20:394/398 of query aligns to 15:388/389 of 4ewtA
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 96% coverage: 15:398/398 of query aligns to 42:427/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 96% coverage: 16:396/398 of query aligns to 47:429/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
34% identity, 81% coverage: 19:342/398 of query aligns to 17:343/398 of 6slfA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
21% identity, 60% coverage: 58:297/398 of query aligns to 51:292/383 of 7uoiA
>WP_011989220.1 NCBI__GCF_000016505.1:WP_011989220.1
MEQLCEVEEIKHLANKYYSEVVNLRRYFHTYPEVSKKEFNTQKKIIEVLEGLSLNIRKAG
GTGVIAELKGGKPGKIVAIRADIDALAIDDEISKDYKSKNKGACHACGHDGHTAILIGVI
KVLCDIRHRIEGTLRFIFQPSEEEVIDGSGAAAIIEDGGLEGVEAIIGAHLWQPIEIGTV
GISKGPVMAASDEFVIIIEGKAGHASMPHQTIDSILTASQIVVALNTIVGRDVDPMKQAV
VSVGVFQSGHIYNAISGKAVLKGTIRSLDEDVRREVLMHIKKIVKHICDMAGAHCSLQKS
SCTYVLNNDSKITDIILEAGKEVMGEGAHEVKPCMSSEDFSYYLQKVPGCFIFIGIGNPK
KGIIYPQHHPKYDIDEMALLYGIEVMSNAALKLLSKLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory