Comparing WP_011989272.1 NCBI__GCF_000016505.1:WP_011989272.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
51% identity, 99% coverage: 4:495/496 of query aligns to 5:494/496 of 8g1yA
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
38% identity, 88% coverage: 6:439/496 of query aligns to 4:423/464 of 4f4fA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
35% identity, 90% coverage: 6:450/496 of query aligns to 7:472/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 91% coverage: 3:455/496 of query aligns to 4:478/514 of Q42598
1vb3A Crystal structure of threonine synthase from escherichia coli
30% identity, 91% coverage: 13:464/496 of query aligns to 10:408/428 of 1vb3A
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
26% identity, 66% coverage: 110:435/496 of query aligns to 124:406/444 of 2c2bA
Sites not aligning to the query:
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 66% coverage: 110:435/496 of query aligns to 199:481/526 of Q9S7B5
Sites not aligning to the query:
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
26% identity, 66% coverage: 110:435/496 of query aligns to 142:408/448 of 2c2gA
>WP_011989272.1 NCBI__GCF_000016505.1:WP_011989272.1
MKEIYYNSTRGLNKNFTASRAILNGISEDGGLFIPHTIPFIDEEELKKLKYMTYKELALC
IIEKFFTDFSKEELKECIDLAYDNKFESDKIVPLEKVGDVFYLELFHGPTLAFKDMALCL
LPHLMKTAAKKQKLHKEIVILTATSGDTGKAALEGFANVEGTKIVVFFPEQGVSKIQKKQ
MVTQQGGNTKVVGIEGNFDDAQSEVKKIFNDHELKEELNENSYRFSSANSINIGRLIPQV
VYYFYGYMELLRRGEINFGNKINFSVPTGNFGNILAAYYAKKMGLPINKLICASNENRVL
YDFFENGTYDAEREFILTISPSMDILISSNLERLIYDISGKDSTVVNKLMTNLSEHSKYT
VSESMKEELKVFYGGFASEEETLKCIKETFDTYQYLMDTHTSVAYSVYKNYLRDTCDDTK
TIVVSTASPFKFTKSVMSALDTKYSYQEDLELVEVMSKIASLEIPAPIRKLEDSKVVHNT
VCKREEMKEEIRKFLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory