SitesBLAST
Comparing WP_012045924.1 NCBI__GCF_000015165.1:WP_012045924.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
53% identity, 97% coverage: 10:517/523 of query aligns to 5:514/517 of Q9JZG1
- D16 (= D21) binding
- H204 (= H209) binding
- H206 (= H211) binding
- N240 (= N245) binding
Sites not aligning to the query:
- 366:517 Required for the condensation reaction. Not required to bind substrate
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
57% identity, 61% coverage: 10:327/523 of query aligns to 2:306/308 of 3rmjB
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
48% identity, 73% coverage: 9:389/523 of query aligns to 82:477/503 of Q9FN52
- G263 (= G180) mutation to E: In gsm2-1; loss of activity and lack of C6, C7 and C8 aliphatic glucosinolates.
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
47% identity, 72% coverage: 8:386/523 of query aligns to 14:407/409 of 6e1jA
- binding coenzyme a: Q30 (= Q24), F60 (= F54), S63 (≠ A57), I95 (≠ L80), R97 (= R82), F121 (= F106), K132 (= K117), L133 (= L118), S322 (= S304), G323 (= G305), I324 (= I306), D327 (= D309), K331 (= K313), L359 (≠ H338), R362 (= R341), H363 (= H342)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: P192 (= P176), T194 (= T178), H225 (= H209), H227 (= H211)
- binding manganese (ii) ion: D27 (= D21), V82 (vs. gap), E84 (vs. gap), H225 (= H209), H227 (= H211)
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
47% identity, 76% coverage: 8:403/523 of query aligns to 81:486/506 of Q9FG67
- S102 (≠ T29) mutation to F: In gsm1-1; loss of conversion of C3 to C4 glucosinolates.
- A290 (≠ S207) mutation to T: In gsm1-2; loss of conversion of C3 to C4 glucosinolates.
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
33% identity, 69% coverage: 11:369/523 of query aligns to 21:371/399 of 6ktqA
- binding 2-oxoglutaric acid: R30 (= R20), R154 (≠ E144), T156 (≠ S146), E158 (= E148), S184 (≠ N174), T188 (= T178), H216 (= H209), H218 (= H211)
- binding coenzyme a: V67 (≠ A57), R96 (= R82), A97 (= A83), F116 (= F106), H128 (≠ L118), E158 (= E148)
- binding zinc ion: E31 (≠ D21), H216 (= H209), H218 (= H211)
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
32% identity, 69% coverage: 14:374/523 of query aligns to 6:366/380 of 4ov9A
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
32% identity, 69% coverage: 14:374/523 of query aligns to 6:364/379 of 4ov4A
Q8F3Q1 (R)-citramalate synthase CimA; LiCMS; EC 2.3.3.21 from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) (see 2 papers)
29% identity, 96% coverage: 11:510/523 of query aligns to 7:515/516 of Q8F3Q1
- R16 (= R20) mutation R->K,Q: Loss of activity.
- RD 16:17 (= RD 20:21) binding
- D17 (= D21) mutation to A: 34-fold increase in Km for pyruvate and 315-fold decrease in kcat.; mutation to N: 4.4-fold increase in Km for pyruvate and 480-fold decrease in kcat.
- L81 (≠ C78) mutation to A: 4.7-fold increase in Km for pyruvate and 15.7-fold decrease in kcat.; mutation to V: 3.3-fold increase in Km for pyruvate and 10.1-fold decrease in kcat.
- F83 (≠ L80) mutation to A: 5-fold increase in Km for acetyl-CoA and 120-fold decrease in kcat.
- L104 (≠ A98) mutation to V: 1.8-fold increase in Km for pyruvate and 3.4-fold decrease in kcat.
- Y144 (≠ H139) binding ; mutation to L: 259-fold increase in Km for pyruvate and 76-fold decrease in kcat.; mutation to V: 114-fold increase in Km for pyruvate and 5.3-fold decrease in kcat.
- E146 (≠ D141) mutation E->D,Q: Minor effects on the binding of acetyl-CoA, but causes a strong decrease in kcat.
- T179 (= T178) binding ; mutation to A: 16.4-fold increase in Km for pyruvate and 186-fold decrease in kcat.
- H302 (= H307) mutation H->A,N: Loss of activity.
- D304 (= D309) mutation to A: 5.2-fold increase in Km for acetyl-CoA and 16.6-fold decrease in kcat.
- N310 (≠ A315) mutation to A: 2.2-fold increase in Km for acetyl-CoA and 1.7-fold decrease in kcat.
- L311 (≠ Q316) mutation to A: 8-fold increase in Km for acetyl-CoA and 6-fold decrease in kcat.
- Y312 (≠ T317) mutation to A: Loss of activity.
- Y430 (≠ V435) mutation to L: No change in Km for acetyl-CoA and 2.3-fold decrease in kcat. Severely impairs inhibition by isoleucine.
- D431 (= D436) mutation to A: 1.8-fold decrease in Km for acetyl-CoA and 5-fold decrease in kcat.
- L451 (= L452) mutation to V: 1.5-fold increase in Km for acetyl-CoA and 4.3 decrease in kcat.
- Y454 (= Y455) mutation to A: 1.4 decrease in Km for acetyl-CoA and 17-fold decrease in kcat. Still inhibited by isoleucine and weakly inhibited by leucine.
- I458 (≠ A459) mutation to A: 1.3-fold decrease in Km for acetyl-CoA and 14-fold decrease in kcat. Abolishes inhibition by isoleucine.
- T464 (= T464) mutation to A: 1.8-fold decrease in Km for acetyl-CoA and 4.3-fold decrease in kcat.
- V468 (≠ A468) mutation to A: No change in Km for acetyl-CoA and 2-fold decrease in kcat. Increases inhibition by isoleucine and leucine becomes an effective inhibitor.
- P493 (= P488) mutation to A: 1.5-fold decrease in Km for acetyl-CoA and 2.6-fold decrease in kcat.
- Q495 (≠ T490) mutation to A: 1.6-fold decrease in Km for acetyl-CoA and 2.8-fold decrease in kcat.
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
31% identity, 69% coverage: 14:372/523 of query aligns to 37:386/418 of Q9Y823
- R43 (= R20) binding ; mutation R->A,K,Q: Abolishes the catalytic activity.
- E44 (≠ D21) binding ; binding ; binding
- Q47 (= Q24) mutation to A: Abolishes the catalytic activity.
- E74 (= E51) mutation to A: Abolishes the catalytic activity.; mutation to Q: Results in a moderate decrease in the turnover number and a slight increase in the Km value for each substrate.
- H103 (≠ A83) binding ; mutation to A: Substantially impairs catalytic efficiency.
- D123 (≠ H104) binding ; mutation to N: Does not affect the catalytic activity but impairs L-lysine inhibition.
- R163 (≠ E144) binding ; mutation R->A,Q: Abolishes the catalytic activity.; mutation to K: Severely diminishes affinity for 2-oxoglutarate and substantially impairs catalytic efficiency.
- S165 (= S146) binding ; mutation to A: Results in a moderate decrease in catalytic efficiency.
- E167 (= E148) mutation E->A,Q: Abolishes the catalytic activity.
- T197 (= T178) binding ; binding ; mutation to A: Exhibits a 25-fold decrease in catalytic efficiency.; mutation to S: Results in a modest decrease in catalytic efficiency.; mutation to V: Abolishes the catalytic activity.
- E222 (≠ S207) mutation to Q: Does not affect the catalytic activity but impairs L-lysine inhibition.
- H224 (= H209) binding ; binding
- H226 (= H211) binding ; binding
- R288 (≠ T274) mutation to K: Does not affect the catalytic activity but impairs L-lysine inhibition.
- Y332 (= Y318) mutation to A: Abolishes the catalytic activity.; mutation to F: Results in a decrease in catalytic efficiency.
- Q364 (≠ E350) mutation to R: Does not affect the catalytic activity but impairs L-lysine inhibition.
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
31% identity, 69% coverage: 14:372/523 of query aligns to 32:381/400 of 3ivtB
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
32% identity, 69% coverage: 14:372/523 of query aligns to 14:352/370 of 3mi3A
3ivsA Homocitrate synthase lys4 (see paper)
31% identity, 70% coverage: 14:381/523 of query aligns to 14:356/364 of 3ivsA
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
30% identity, 70% coverage: 14:380/523 of query aligns to 6:365/376 of O87198
- R12 (= R20) binding
- E13 (≠ D21) binding
- H72 (≠ A75) binding ; mutation to L: Significant decrease in sensitivity to lysine inhibition. Large decrease in affinity for 2-oxoglutarate. Almost no effect on affinity for acetyl-CoA and on turnover number.
- D92 (≠ H104) binding
- R133 (≠ E144) binding
- S135 (= S146) binding
- T166 (= T178) binding ; binding
- H195 (= H209) binding
- H197 (= H211) binding
3bliA Crystal structure of the catalytic domain of licms in complexed with pyruvate and acetyl-coa (see paper)
30% identity, 61% coverage: 11:330/523 of query aligns to 1:311/311 of 3bliA
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
30% identity, 70% coverage: 14:380/523 of query aligns to 5:336/347 of 3a9iA
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
30% identity, 61% coverage: 14:334/523 of query aligns to 6:313/314 of 2zyfA
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
29% identity, 61% coverage: 14:334/523 of query aligns to 6:311/312 of 2ztjA
3hpzB Crystal structure of mycobacterium tuberculosis leua complexed with bromopyruvate
25% identity, 93% coverage: 19:504/523 of query aligns to 62:574/576 of 3hpzB
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
25% identity, 93% coverage: 19:504/523 of query aligns to 62:574/577 of 3figB
Query Sequence
>WP_012045924.1 NCBI__GCF_000015165.1:WP_012045924.1
MSSTTPSDKDRVVIFDTTLRDGEQCPGATMTFEEKLNIAAMLDGMGVDVIEAGFPIASDG
DFEAVNEIAKRTQNAVVCGLSRAGAKDIDRCAEAIRPAKRGRIHTFLSTSPVHMKYKLQM
EPQAVFELVVSSVTRARNHTDDVEWSSEDGTRTEFDFLCRCVEAAIKAGATTINIPDTVG
YAVPEEYYDLFKRVRETVPNSDKAVFSVHCHNDLGMAVANSMAGIRAGARQIECTINGIG
ERAGNAALEEVVMAMRVRNDKLPFWNKIDTTQLTHASKVVSAATSFPVQYNKAIVGRNAF
AHESGIHQDGMLKNAQTYEIMLPETVGVKQTSLVMGKHSGRHAFIHKLEEMGHKLAGNQV
EDAFVRFKALADRKKHIYDEDIEALIDEGMVSAHDRIKLLSLSVIAGTRGPQRATMKLDV
DGVTKIEESEGNGPVDAVFNCIKSLVPHEAKLELYQVHAVTEGTDAQAEVSVRLSQDGRS
MTARAADPDTLVASAKAYLGALNKLVMKRQRDVAQGAAAAAAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory