Comparing WP_012046337.1 NCBI__GCF_000015165.1:WP_012046337.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
58% identity, 95% coverage: 4:300/313 of query aligns to 1:296/304 of 4ur8A
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
58% identity, 95% coverage: 4:300/313 of query aligns to 1:296/310 of 5hwnB
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
31% identity, 94% coverage: 8:302/313 of query aligns to 2:290/295 of 3l21B
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
31% identity, 94% coverage: 8:302/313 of query aligns to 4:292/297 of 5j5dA
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
31% identity, 94% coverage: 8:302/313 of query aligns to 3:291/296 of 1xxxA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 94% coverage: 8:302/313 of query aligns to 7:295/300 of P9WP25
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 90% coverage: 16:296/313 of query aligns to 4:281/292 of Q07607
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
31% identity, 74% coverage: 22:252/313 of query aligns to 10:240/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
31% identity, 74% coverage: 22:252/313 of query aligns to 10:240/294 of 4i7wA
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
30% identity, 87% coverage: 22:292/313 of query aligns to 10:279/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
30% identity, 87% coverage: 22:292/313 of query aligns to 10:279/296 of 7lvlA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
28% identity, 86% coverage: 22:290/313 of query aligns to 10:275/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
28% identity, 86% coverage: 22:290/313 of query aligns to 10:275/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
28% identity, 86% coverage: 22:290/313 of query aligns to 10:275/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
28% identity, 86% coverage: 22:290/313 of query aligns to 10:275/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
28% identity, 86% coverage: 22:290/313 of query aligns to 10:275/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
28% identity, 86% coverage: 22:290/313 of query aligns to 10:275/291 of 3pueB
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
32% identity, 52% coverage: 23:186/313 of query aligns to 14:179/291 of 3di1B
Sites not aligning to the query:
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
32% identity, 52% coverage: 23:186/313 of query aligns to 14:179/295 of Q5HG25
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
29% identity, 84% coverage: 15:276/313 of query aligns to 4:267/298 of 4ptnA
>WP_012046337.1 NCBI__GCF_000015165.1:WP_012046337.1
MSKMTPQEMAAKIGSGLLSFPVTPFKADYSFDEATYRANMDWLCGYEVAGLFAAGGTGEF
FSLTPAEVPEVVRVAVDETRGRVPVLAGTGYGTAIAREIAIGAEKAGADGLLLLPPYLTH
AEQDGLAAHVEAVCKSVKIGVIVYNRDNAILQPDTLARLCERCPNLVGYKDGIGDIELMT
RVYSKMGDRLTYIGGLPTAETFALPYLDMGVTTYSSAVFNFVPEFATNFYAAVRKRDHAT
IHAGLKDFILPLIAIRNRKKGYAVSIIKAGMKVIGRDSGPVRLPLTDLTETEMAELTALV
KALPAAAVSQAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory