Comparing WP_012047258.1 NCBI__GCF_000015165.1:WP_012047258.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
29% identity, 81% coverage: 16:292/341 of query aligns to 19:306/347 of 2vatA
Sites not aligning to the query:
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
29% identity, 81% coverage: 16:292/341 of query aligns to 20:308/350 of 2vavB
Sites not aligning to the query:
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
29% identity, 93% coverage: 3:318/341 of query aligns to 2:339/358 of P45131
Sites not aligning to the query:
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
26% identity, 86% coverage: 17:310/341 of query aligns to 24:343/387 of Q6FEQ3
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 48% coverage: 20:183/341 of query aligns to 95:274/504 of Q10341
Sites not aligning to the query:
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
25% identity, 93% coverage: 1:316/341 of query aligns to 3:344/366 of 6puxA
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
25% identity, 91% coverage: 5:316/341 of query aligns to 8:343/367 of 8f2lA
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
25% identity, 91% coverage: 5:316/341 of query aligns to 8:343/368 of 7rytB
Sites not aligning to the query:
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
25% identity, 90% coverage: 9:316/341 of query aligns to 3:324/346 of 5w8oB
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
30% identity, 50% coverage: 17:185/341 of query aligns to 20:204/374 of D2Z028
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
27% identity, 53% coverage: 5:185/341 of query aligns to 9:206/366 of 6ioiA
Sites not aligning to the query:
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
27% identity, 53% coverage: 5:185/341 of query aligns to 9:206/375 of 6iohA
Sites not aligning to the query:
>WP_012047258.1 NCBI__GCF_000015165.1:WP_012047258.1
MTSVADYQIFEAGDVVLQSGATVPSLRLAYKTYGTLNAAKDNVILYPTSFSAQHVDTEWL
VGPADILDSDRYFIIIPNLFGNGLSSSPSNTPPADAPFPAISYHDAVAIQRRLVEEQFGI
TRIALVYGWSMGGMQAYHWAACHPDMVERAAVVCGSARCSPYNHVFLDAVKAALIADPAY
KNGRFVAKPVAGLRAMGRIYAGWAMSYEFYRDEVWREQGFAAQEDYLAATWDTAFAHRDA
NNLLAQIAIWQNGDISHCSAFGGDLDRALSAITAHMLLMPGQTDRYFDWRDNERELPKLV
NASSAVLRPIPSIHGHRAGNPIRIPADRDFIKANILTLLQS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory