Comparing WP_012101303.1 NCBI__GCF_000016505.1:WP_012101303.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
43% identity, 95% coverage: 5:258/268 of query aligns to 7:255/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
43% identity, 95% coverage: 5:258/268 of query aligns to 5:253/365 of 2j5tD
Sites not aligning to the query:
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
36% identity, 88% coverage: 4:239/268 of query aligns to 2:219/241 of 2akoA
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
35% identity, 95% coverage: 5:258/268 of query aligns to 5:213/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
35% identity, 95% coverage: 5:258/268 of query aligns to 5:211/323 of 2j5vA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
36% identity, 95% coverage: 4:258/268 of query aligns to 14:256/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
34% identity, 95% coverage: 4:258/268 of query aligns to 14:234/236 of 7f5xA
8j0gB Gk monomer complexes with glutamate and atp
32% identity, 95% coverage: 4:258/268 of query aligns to 9:267/274 of 8j0gB
8j0eB Gk monomer complexes with catalytic intermediate
32% identity, 95% coverage: 4:258/268 of query aligns to 12:262/269 of 8j0eB
8j0fA Gk tetramer with adjacent hooks at reaction state
31% identity, 95% coverage: 4:258/268 of query aligns to 13:261/270 of 8j0fA
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
39% identity, 33% coverage: 166:254/268 of query aligns to 164:248/253 of 7n9dA
Sites not aligning to the query:
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
35% identity, 33% coverage: 166:254/268 of query aligns to 166:252/261 of 7lnuB
Sites not aligning to the query:
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
35% identity, 33% coverage: 166:254/268 of query aligns to 165:251/260 of 7lntB
Sites not aligning to the query:
7lnwA I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
34% identity, 33% coverage: 166:254/268 of query aligns to 164:247/256 of 7lnwA
Sites not aligning to the query:
7lnxB I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
30% identity, 33% coverage: 166:254/268 of query aligns to 168:238/247 of 7lnxB
Sites not aligning to the query:
3ll9B X-ray structures of isopentenyl phosphate kinase (see paper)
26% identity, 53% coverage: 114:254/268 of query aligns to 125:243/249 of 3ll9B
Sites not aligning to the query:
7lnuA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
29% identity, 33% coverage: 166:254/268 of query aligns to 165:230/239 of 7lnuA
Sites not aligning to the query:
7lntA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
29% identity, 33% coverage: 166:254/268 of query aligns to 165:230/238 of 7lntA
Sites not aligning to the query:
8u0mA Crystal structure of isopentenyl phosphate kinase from thermococcus paralvinellae bound to (e)-2-methylbut-2-en-1-yl monophosphate and atp (see paper)
26% identity, 47% coverage: 133:259/268 of query aligns to 108:244/247 of 8u0mA
Sites not aligning to the query:
8u0nA Crystal structure of isopentenyl phosphate kinase from thermococcus paralvinellae bound to 2-cyclopentylideneethyl monophosphate and adp (see paper)
26% identity, 47% coverage: 133:259/268 of query aligns to 107:242/245 of 8u0nA
Sites not aligning to the query:
>WP_012101303.1 NCBI__GCF_000016505.1:WP_012101303.1
MKSRIVVKVGTSTLTSENGKIDLRNIEHLVRVLSDIMAKGVEVVLVTSAAITVGYEKMGL
PARPKELNLTQAAAAVGQCELMHIYDKLFNEYGRVAAQILLDEEDMCCEKRRQNLLRTFL
TLLEHGIIPIVNENDSVSYQEIESADKLFGDNDTLSAHVALLCGADKLILLSDIDGFYEQ
DPRENQNAELIQQVSCIDEHIKKLAGGSGTARGTGGMITKIHAAELVTPYGCEMFIVNGA
YPNYIYSILEGVSVGTYFKTTKEIQTIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory