SitesBLAST
Comparing WP_012102441.1 NCBI__GCF_000016505.1:WP_012102441.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
39% identity, 97% coverage: 12:563/569 of query aligns to 18:572/596 of 1t9cA
- active site: Y29 (= Y23), G31 (= G25), G32 (= G26), A33 (≠ N27), I34 (≠ V28), E55 (≠ D49), T78 (= T72), F117 (= F117), Q118 (= Q118), E119 (= E119), K167 (≠ M167), R227 (vs. gap), M263 (≠ C261), V290 (≠ A288), V406 (= V396), L431 (= L421), G432 (= G422), M434 (= M424), D459 (= D449), N486 (= N476), E488 (≠ T478), Q489 (≠ L479), M491 (≠ L481), V492 (= V482), W495 (≠ F485), L517 (= L508), G522 (= G513), L523 (≠ I514), K556 (≠ S547)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G26), V107 (= V101), P108 (≠ G102), F117 (= F117), K167 (≠ M167), D288 (≠ V286), R289 (= R287), W495 (≠ F485)
- binding flavin-adenine dinucleotide: R157 (= R157), G216 (= G215), A217 (≠ G216), G218 (= G217), N221 (≠ G221), T243 (= T241), L244 (= L242), Q245 (≠ M243), L261 (≠ M259), M263 (≠ C261), H264 (≠ Y262), G283 (= G281), A284 (≠ N282), R285 (= R283), D287 (= D285), R289 (= R287), V290 (≠ A288), E316 (≠ D306), V317 (= V307), N321 (≠ E311), G334 (= G324), D335 (= D325), A336 (≠ V326), M411 (= M401), G429 (= G419), G430 (= G420)
- binding magnesium ion: D459 (= D449), N486 (= N476), E488 (≠ T478)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
39% identity, 97% coverage: 12:563/569 of query aligns to 18:572/596 of 1t9dA
- active site: Y29 (= Y23), G31 (= G25), G32 (= G26), A33 (≠ N27), I34 (≠ V28), E55 (≠ D49), T78 (= T72), F117 (= F117), Q118 (= Q118), E119 (= E119), K167 (≠ M167), R227 (vs. gap), M263 (≠ C261), V290 (≠ A288), V406 (= V396), L431 (= L421), G432 (= G422), M434 (= M424), D459 (= D449), N486 (= N476), E488 (≠ T478), Q489 (≠ L479), M491 (≠ L481), V492 (= V482), W495 (≠ F485), L517 (= L508), G522 (= G513), L523 (≠ I514), K556 (≠ S547)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G26), A33 (≠ N27), V107 (= V101), P108 (≠ G102), F117 (= F117), K167 (≠ M167), M263 (≠ C261), D288 (≠ V286), R289 (= R287), W495 (≠ F485)
- binding flavin-adenine dinucleotide: R157 (= R157), G216 (= G215), A217 (≠ G216), G218 (= G217), N221 (≠ G221), T243 (= T241), L244 (= L242), Q245 (≠ M243), M260 (≠ F258), L261 (≠ M259), H264 (≠ Y262), G283 (= G281), A284 (≠ N282), R285 (= R283), D287 (= D285), R289 (= R287), V290 (≠ A288), E316 (≠ D306), V317 (= V307), N321 (≠ E311), G334 (= G324), D335 (= D325), A336 (≠ V326), Q410 (= Q400), M411 (= M401), G429 (= G419), G430 (= G420)
- binding magnesium ion: D459 (= D449), N486 (= N476), E488 (≠ T478)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (≠ D49), P81 (= P75), Q118 (= Q118), G432 (= G422), M434 (= M424), M464 (= M454)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/585 of 5k2oA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ C261), R292 (= R287), W489 (≠ F485), S568 (≠ G557)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), G286 (= G281), R288 (= R283), D290 (= D285), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), Q404 (= Q400), M405 (= M401), G423 (= G419)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (≠ N399), M428 (= M424), D453 (= D449), G454 (= G450), S455 (= S451), N480 (= N476), H482 (≠ T478), L483 (= L479), G484 (= G480), M485 (≠ L481), V486 (= V482)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
39% identity, 97% coverage: 12:563/569 of query aligns to 19:573/597 of 1t9aA
- active site: Y30 (= Y23), G32 (= G25), G33 (= G26), A34 (≠ N27), I35 (≠ V28), E56 (≠ D49), T79 (= T72), F118 (= F117), Q119 (= Q118), E120 (= E119), K168 (≠ M167), R228 (vs. gap), M264 (≠ C261), V291 (≠ A288), V407 (= V396), L432 (= L421), G433 (= G422), M435 (= M424), D460 (= D449), N487 (= N476), E489 (≠ T478), Q490 (≠ L479), M492 (≠ L481), V493 (= V482), W496 (≠ F485), L518 (= L508), G523 (= G513), L524 (≠ I514), K557 (≠ S547)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G26), V108 (= V101), P109 (≠ G102), F118 (= F117), K168 (≠ M167), M264 (≠ C261), D289 (≠ V286), R290 (= R287), M492 (≠ L481), V493 (= V482), W496 (≠ F485)
- binding flavin-adenine dinucleotide: R158 (= R157), G217 (= G215), A218 (≠ G216), G219 (= G217), N222 (≠ G221), T244 (= T241), L245 (= L242), Q246 (≠ M243), L262 (≠ M259), M264 (≠ C261), H265 (≠ Y262), G284 (= G281), A285 (≠ N282), R286 (= R283), D288 (= D285), R290 (= R287), V291 (≠ A288), E317 (≠ D306), V318 (= V307), N322 (≠ E311), G335 (= G324), D336 (= D325), A337 (≠ V326), Q411 (= Q400), M412 (= M401), G430 (= G419), G431 (= G420)
- binding magnesium ion: D460 (= D449), N487 (= N476), E489 (≠ T478)
- binding propyl trihydrogen diphosphate: V407 (= V396), G408 (= G397), Q409 (= Q398), H410 (≠ N399), M435 (= M424), G459 (= G448), D460 (= D449), A461 (≠ G450), S462 (= S451), N487 (= N476), E489 (≠ T478), Q490 (≠ L479), G491 (= G480), M492 (≠ L481)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G422), M435 (= M424), M465 (= M454)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
38% identity, 98% coverage: 5:563/569 of query aligns to 100:659/670 of P17597
- A122 (≠ N27) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ A29) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (≠ D49) binding
- S186 (= S91) binding
- P197 (≠ K111) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (= R113) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q118) binding
- K220 (= K131) binding
- R246 (= R157) binding ; binding
- K256 (≠ M167) binding
- G308 (= G216) binding
- TL 331:332 (= TL 241:242) binding
- C340 (≠ L250) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ MGCY 259:262) binding
- GVRFD 371:375 (≠ GNRFD 281:285) binding
- DR 376:377 (≠ VR 286:287) binding
- DI 395:396 (≠ DV 306:307) binding
- DV 414:415 (= DV 325:326) binding
- QH 487:488 (≠ QN 398:399) binding
- GG 508:509 (= GG 419:420) binding
- GAM 511:513 (≠ GNM 422:424) binding
- D538 (= D449) binding
- DGS 538:540 (= DGS 449:451) binding
- N565 (= N476) binding
- NQHLGM 565:570 (≠ NNTLGL 476:481) binding
- H567 (≠ T478) binding
- W574 (≠ F485) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ G557) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (≠ N399), G426 (= G422), M428 (= M424), G452 (= G448), D453 (= D449), G454 (= G450), S455 (= S451), M458 (= M454), N480 (= N476), H482 (≠ T478), L483 (= L479), G484 (= G480), M485 (≠ L481), V486 (= V482)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), M266 (≠ C261), H267 (≠ Y262), G286 (= G281), V287 (≠ N282), R288 (= R283), D290 (= D285), R292 (= R287), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), M405 (= M401), G423 (= G419)
- binding magnesium ion: F370 (≠ Y364), D453 (= D449), M458 (= M454), Q461 (= Q457), N480 (= N476), H482 (≠ T478), K533 (≠ A522)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ C261), R292 (= R287), M485 (≠ L481), W489 (≠ F485), S568 (≠ G557)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 5wj1A
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), M263 (≠ F258), L264 (≠ M259), G286 (= G281), R288 (= R283), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ C261), D291 (≠ V286), R292 (= R287), M485 (≠ L481), W489 (≠ F485), S568 (≠ G557)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (≠ N399), M428 (= M424), D453 (= D449), G454 (= G450), S455 (= S451), M458 (= M454), N480 (= N476), H482 (≠ T478), L483 (= L479), G484 (= G480), M485 (≠ L481), V486 (= V482)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 5k6tA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ Y262), R292 (= R287), M485 (≠ L481), W489 (≠ F485), S568 (≠ G557)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), G286 (= G281), R288 (= R283), D290 (= D285), R292 (= R287), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), Q404 (= Q400), M405 (= M401), G423 (= G419)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (≠ N399), G426 (= G422), M428 (= M424), G452 (= G448), G454 (= G450), S455 (= S451), N480 (= N476), H482 (≠ T478), L483 (= L479), G484 (= G480)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 5k6rA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R287), W489 (≠ F485), S568 (≠ G557)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), M266 (≠ C261), G286 (= G281), R288 (= R283), R292 (= R287), V293 (≠ A288), D310 (= D306), I311 (≠ V307), G328 (= G324), D329 (= D325), V330 (= V326), M405 (= M401), G423 (= G419)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (≠ N399), G426 (= G422), M428 (= M424), D453 (= D449), G454 (= G450), S455 (= S451), M458 (= M454), N480 (= N476), H482 (≠ T478), L483 (= L479), G484 (= G480), M485 (≠ L481), V486 (= V482)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 1z8nA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K131), R161 (= R157), Y191 (≠ R182), R194 (≠ I185), D291 (≠ V286), R292 (= R287), D312 (= D308), W489 (≠ F485), G569 (= G558)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), G265 (= G260), M266 (≠ C261), H267 (≠ Y262), G286 (= G281), V287 (≠ N282), R288 (= R283), D290 (= D285), R292 (= R287), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476)
- binding thiamine diphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (≠ N399), G426 (= G422), M428 (= M424), G452 (= G448), G454 (= G450), S455 (= S451), N480 (= N476), H482 (≠ T478), L483 (= L479), G484 (= G480), M485 (≠ L481), V486 (= V482)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 1yi1A
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (≠ V286), R292 (= R287), W489 (≠ F485), S568 (≠ G557)
- binding flavin-adenine dinucleotide: R161 (= R157), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), M263 (≠ F258), L264 (≠ M259), G265 (= G260), M266 (≠ C261), H267 (≠ Y262), G286 (= G281), V287 (≠ N282), R288 (= R283), D290 (= D285), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 1yi0A
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ V286), R292 (= R287), W489 (≠ F485), S568 (≠ G557)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), G265 (= G260), M266 (≠ C261), H267 (≠ Y262), G286 (= G281), V287 (≠ N282), R288 (= R283), D290 (= D285), R292 (= R287), V293 (≠ A288), D310 (= D306), I311 (≠ V307), G328 (= G324), D329 (= D325), V330 (= V326), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 1yhzA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (≠ V286), R292 (= R287), M485 (≠ L481), W489 (≠ F485), S568 (≠ G557)
- binding flavin-adenine dinucleotide: R161 (= R157), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), M266 (≠ C261), H267 (≠ Y262), G286 (= G281), V287 (≠ N282), R288 (= R283), D290 (= D285), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), Q404 (= Q400), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 1yhyA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ V286), R292 (= R287), V486 (= V482), W489 (≠ F485), S568 (≠ G557)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), G265 (= G260), M266 (≠ C261), H267 (≠ Y262), G286 (= G281), V287 (≠ N282), R288 (= R283), D290 (= D285), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), Q404 (= Q400), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 1ybhA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (≠ C261), D291 (≠ V286), R292 (= R287), M485 (≠ L481), W489 (≠ F485), S568 (≠ G557)
- binding flavin-adenine dinucleotide: R161 (= R157), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), M266 (≠ C261), H267 (≠ Y262), G286 (= G281), V287 (≠ N282), R288 (= R283), D290 (= D285), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), Q404 (= Q400), M405 (= M401), G423 (= G419), G424 (= G420)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/583 of 5k3sA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (≠ N27), S38 (≠ V28), E59 (≠ D49), T82 (= T72), F121 (= F117), Q122 (= Q118), E123 (= E119), K171 (≠ M167), M266 (≠ C261), V293 (≠ A288), V400 (= V396), G426 (= G422), M428 (= M424), D453 (= D449), N480 (= N476), H482 (≠ T478), L483 (= L479), M485 (≠ L481), V486 (= V482), W489 (≠ F485), H558 (≠ S547)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R287), M485 (≠ L481), W489 (≠ F485), G569 (= G558)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), L264 (≠ M259), M266 (≠ C261), G286 (= G281), R288 (= R283), D290 (= D285), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), M405 (= M401), G423 (= G419)
- binding magnesium ion: D453 (= D449), N480 (= N476), H482 (≠ T478)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (≠ N399), G426 (= G422), M428 (= M424), D453 (= D449), G454 (= G450), S455 (= S451), N480 (= N476), H482 (≠ T478), L483 (= L479), G484 (= G480), M485 (≠ L481), V486 (= V482)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 15:574/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ C261), R292 (= R287), W489 (≠ F485), S568 (≠ G557)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V396), G401 (= G397), Q402 (= Q398), H403 (≠ N399), G426 (= G422), M428 (= M424), G452 (= G448), D453 (= D449), G454 (= G450), S455 (= S451), L483 (= L479), G484 (= G480), M485 (≠ L481), V486 (= V482)
- binding flavin-adenine dinucleotide: R161 (= R157), G222 (= G215), G223 (= G216), G224 (= G217), T246 (= T241), L247 (= L242), M248 (= M243), M263 (≠ F258), L264 (≠ M259), M266 (≠ C261), H267 (≠ Y262), G286 (= G281), R288 (= R283), V293 (≠ A288), D310 (= D306), I311 (≠ V307), D329 (= D325), V330 (= V326), M405 (= M401), G423 (= G419)
- binding magnesium ion: A37 (≠ N27), T82 (= T72), S83 (≠ V73), Q122 (= Q118), Y381 (= Y377), D453 (= D449), M458 (= M454), Q461 (= Q457), N480 (= N476), H482 (≠ T478), K533 (≠ A522)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 14:573/582 of 3ea4A
- active site: Y32 (= Y23), G34 (= G25), G35 (= G26), A36 (≠ N27), S37 (≠ V28), E58 (≠ D49), T81 (= T72), F120 (= F117), Q121 (= Q118), E122 (= E119), K170 (≠ M167), M265 (≠ C261), V292 (≠ A288), V399 (= V396), G425 (= G422), M427 (= M424), D452 (= D449), N479 (= N476), H481 (≠ T478), L482 (= L479), M484 (≠ L481), V485 (= V482), W488 (≠ F485), H557 (≠ S547)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (≠ V286), R291 (= R287), W488 (≠ F485), S567 (≠ G557)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R157), G221 (= G215), G222 (= G216), G223 (= G217), T245 (= T241), L246 (= L242), M247 (= M243), L263 (≠ M259), G264 (= G260), M265 (≠ C261), H266 (≠ Y262), G285 (= G281), R287 (= R283), D289 (= D285), R291 (= R287), D309 (= D306), I310 (≠ V307), G327 (= G324), D328 (= D325), V329 (= V326), M404 (= M401), G422 (= G419)
- binding magnesium ion: D452 (= D449), N479 (= N476), H481 (≠ T478)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V396), G400 (= G397), Q401 (= Q398), H402 (≠ N399), M427 (= M424), G451 (= G448), D452 (= D449), G453 (= G450), S454 (= S451), N479 (= N476), H481 (≠ T478), L482 (= L479), G483 (= G480), M484 (≠ L481), V485 (= V482)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
38% identity, 98% coverage: 5:563/569 of query aligns to 14:573/582 of 3e9yA
- active site: Y32 (= Y23), G34 (= G25), G35 (= G26), A36 (≠ N27), S37 (≠ V28), E58 (≠ D49), T81 (= T72), F120 (= F117), Q121 (= Q118), E122 (= E119), K170 (≠ M167), M265 (≠ C261), V292 (≠ A288), V399 (= V396), G425 (= G422), M427 (= M424), D452 (= D449), N479 (= N476), H481 (≠ T478), L482 (= L479), M484 (≠ L481), V485 (= V482), W488 (≠ F485), H557 (≠ S547)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (≠ V286), R291 (= R287), W488 (≠ F485), S567 (≠ G557)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R157), G221 (= G215), G222 (= G216), G223 (= G217), T245 (= T241), L246 (= L242), M247 (= M243), L263 (≠ M259), G285 (= G281), R287 (= R283), D289 (= D285), R291 (= R287), D309 (= D306), I310 (≠ V307), G327 (= G324), D328 (= D325), V329 (= V326), M404 (= M401), G422 (= G419)
- binding magnesium ion: D452 (= D449), N479 (= N476), H481 (≠ T478)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V396), G400 (= G397), Q401 (= Q398), H402 (≠ N399), M427 (= M424), G451 (= G448), G453 (= G450), S454 (= S451), N479 (= N476), H481 (≠ T478), L482 (= L479), G483 (= G480), M484 (≠ L481), V485 (= V482)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
37% identity, 98% coverage: 5:563/569 of query aligns to 94:653/664 of P09114
- P191 (≠ K111) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ F485) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
Query Sequence
>WP_012102441.1 NCBI__GCF_000016505.1:WP_012102441.1
MINISKMIANKLKENKCKVIFEYPGGNVAPILDAVKLDGTIDLVVTRNDQAASLMADAYA
RVTGEVGVCMATVGPGATNLVTGIANAYFDSIPLVAITGQVGTGSLKGIKKTRQIGFQEV
DIVNIVKPITKWSCMITKPEDVNQVIDEAFRIAREGRPGPVLIDIPMDVQRSMLQKLDIL
NRVDIIEKRSIVEQKKINLLIQKINLSSKPVIIAGGGVILGNAENELKVLAEKSQIPVAN
TLMGLGSFDLNSKLALGFMGCYGSRACNKILAEADLIIALGNRFDVRAIGTEINKFQEGK
FIIHVDVDKAEINNTVKTNLAINGDVKEVLKLIIDRLNEINIDTKKWLDYISELKYKFNL
DREYRLSDEYDKVRPQYIIKEISNLTNGKAIITSDVGQNQMWTAQFYKYRYTRTNLTSGG
LGNMGYGLPAAIAAKYAKKDAQVINITGDGSFQMNMQELGTAVAYNLPVKIFILKNNTLG
LVKQFQDKTFLGKATSTVIKYNPDFIKLAEVYGIKGLRISKASEIKGIVKEALNYDGTVI
VECYIDSNELAIPEIEGGHYIDDQYPYNS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory