SitesBLAST
Comparing WP_012170279.1 NCBI__GCF_000010525.1:WP_012170279.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
36% identity, 96% coverage: 7:194/196 of query aligns to 4:192/207 of 1h2fA
- active site: R8 (= R11), H9 (= H12), N15 (= N18), R58 (= R65), E82 (= E92), H150 (= H155)
- binding phosphate ion: G142 (= G148), E143 (≠ D149)
- binding trivanadate: R8 (= R11), H9 (= H12), N15 (= N18), Q21 (= Q24), R58 (= R65), E82 (= E92), H150 (= H155), G151 (= G156), V152 (≠ G157)
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
36% identity, 96% coverage: 7:194/196 of query aligns to 4:192/207 of 1h2eA
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
38% identity, 69% coverage: 5:139/196 of query aligns to 4:130/223 of P9WIC7
- R10 (= R11) mutation to A: Loss of phosphatase activity.
- H11 (= H12) active site, Tele-phosphohistidine intermediate; mutation to A: Almost completely abolished phosphatase activity.
- N17 (= N18) mutation to A: About 5% of wild-type phosphatase activity.
- K47 (≠ E52) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- R60 (= R65) mutation to A: Loss of phosphatase activity.
Sites not aligning to the query:
- 159 H→A: About 5% of wild-type phosphatase activity.
- 209 L→E: Disrupts dimerization of the enzyme, which exists as a monomer and has lost its ability to perform dephosphorylation.
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
38% identity, 69% coverage: 5:139/196 of query aligns to 3:129/217 of 4pzaB
Sites not aligning to the query:
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
38% identity, 69% coverage: 5:139/196 of query aligns to 2:128/209 of 4qihA
Sites not aligning to the query:
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
27% identity, 97% coverage: 5:195/196 of query aligns to 220:401/425 of 5htkA
- active site: R226 (= R11), H227 (= H12), N233 (= N18), R276 (= R65), E296 (= E92), H361 (= H155)
- binding adenosine-5'-triphosphate: A397 (= A191), Y398 (≠ F192)
- binding 6-O-phosphono-beta-D-fructofuranose: H227 (= H12), I238 (≠ L23), G239 (≠ Q24), E296 (= E92), Y307 (≠ W103), R321 (= R117), K325 (≠ P121), Y336 (= Y132), Q362 (≠ G156), R366 (= R160)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 17, 18, 19, 20, 21, 22, 140, 144, 145, 146
- binding citrate anion: 48, 61, 72, 99, 100, 167
1k6mA Crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 213:362/432 of 1k6mA
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 13, 14, 15, 16, 17, 18, 92, 120, 131, 134, 135, 136, 184, 210
O60825 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see 2 papers)
27% identity, 97% coverage: 5:195/196 of query aligns to 250:431/505 of O60825
Sites not aligning to the query:
- 466 modified: Phosphoserine; by AMPK; S→E: Constitutively active mutant that cannot be phosphorylated and further activated by AMPK.
- 468 modified: Phosphothreonine
- 483 modified: Phosphoserine; by BRAF
- 486 modified: Phosphoserine
- 493 modified: Phosphoserine
6ic0A Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 4 (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 229:378/428 of 6ic0A
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-pyrimidin-5-yl-pyridine-4-carboxamide: 28, 29, 32, 33, 135, 137, 146, 149, 197, 200, 224, 226, 404
- binding pyrophosphate 2-: 26, 27, 28, 29, 30, 31, 32, 151, 407
6ibxA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 5 (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 229:378/429 of 6ibxA
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-[(3~{S})-1-methylpiperidin-3-yl]pyridine-4-carboxamide: 28, 32, 33, 135, 137, 142, 146, 149, 150, 197, 224
- binding pyrophosphate 2-: 27, 28, 29, 30, 31, 32, 151, 407
6hvjA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 3 (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 230:379/430 of 6hvjA
- active site: R236 (= R11), H237 (= H12), N243 (= N18), S286 (≠ R65), E306 (= E92), H371 (= H155)
- binding 6-O-phosphono-beta-D-fructofuranose: G249 (≠ Q24), E306 (= E92), Y317 (≠ W103), R331 (= R117), K335 (≠ P121), Y346 (= Y132), Q372 (≠ G156), R376 (= R160)
Sites not aligning to the query:
- binding 8-(3-methyl-1-benzofuran-5-yl)-~{N}-(4-methylsulfonylpyridin-3-yl)quinoxalin-6-amine: 29, 33, 34, 136, 138, 143, 147, 151, 198, 225, 407
- binding phosphate ion: 28, 29, 30, 31, 32, 152
6ibzA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 7 (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 231:380/431 of 6ibzA
Sites not aligning to the query:
- binding 2-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-(pyrimidin-5-ylmethyl)benzenesulfonamide: 30, 34, 35, 137, 139, 144, 148, 152, 199, 202, 226, 228
- binding phosphate ion: 28, 29, 30, 31, 32, 33, 153
6hvhA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 1 (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 231:380/431 of 6hvhA
- active site: R237 (= R11), H238 (= H12), N244 (= N18), S287 (≠ R65), E307 (= E92), H372 (= H155)
- binding 6-O-phosphono-beta-D-fructofuranose: I249 (≠ L23), G250 (≠ Q24), E307 (= E92), Y318 (≠ W103), R332 (= R117), K336 (≠ P121), Y347 (= Y132), Q373 (≠ G156), R377 (= R160)
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-(oxan-4-yl)pyridine-4-carboxamide: 30, 34, 35, 137, 139, 144, 148, 151, 152, 199, 202, 226, 228
- binding pyrophosphate 2-: 29, 30, 31, 32, 33, 34, 153, 409
6ibyA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 6 (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 228:377/428 of 6ibyA
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-[(3~{S})-1-methylpyrrolidin-3-yl]pyridine-4-carboxamide: 27, 31, 32, 134, 136, 145, 148, 196, 199, 200, 223
- binding pyrophosphate 2-: 25, 26, 27, 28, 29, 30, 31, 150, 406
3qpuA Pfkfb3 in complex with ppi (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 239:388/439 of 3qpuA
Sites not aligning to the query:
- binding pyrophosphate 2-: 36, 37, 38, 39, 40, 41, 42, 64, 67, 91, 119, 160, 161, 186, 417
2dwpA A pseudo substrate complex of 6-phosphofructo-2-kinase of pfkfb (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 232:381/431 of 2dwpA
- active site: R238 (= R11), H239 (= H12), N245 (= N18), S288 (≠ R65), E308 (= E92), H373 (= H155)
- binding 6-O-phosphono-beta-D-fructofuranose: I250 (≠ L23), G251 (≠ Q24), E308 (= E92), Y319 (≠ W103), R333 (= R117), K337 (≠ P121), Y348 (= Y132), Q374 (≠ G156), R378 (= R160)
Sites not aligning to the query:
- binding phosphomethylphosphonic acid adenylate ester: 29, 30, 31, 32, 33, 34, 35, 138, 149, 152, 153, 154, 203, 410
- binding 6-O-phosphono-beta-D-fructofuranose: 57, 60, 111, 112, 118, 175, 179, 426
6hviA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 2 (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 233:382/433 of 6hviA
- active site: R239 (= R11), H240 (= H12), N246 (= N18), S289 (≠ R65), E309 (= E92), H374 (= H155)
- binding 6-O-phosphono-beta-D-fructofuranose: G252 (≠ Q24), E309 (= E92), Y320 (≠ W103), R334 (= R117), K338 (≠ P121), Y349 (= Y132), Q375 (≠ G156), R379 (= R160)
Sites not aligning to the query:
- binding 8-[3-(dimethylamino)phenyl]-~{N}-(4-methylsulfonylpyridin-3-yl)quinoxalin-6-amine: 32, 33, 36, 37, 139, 141, 146, 150, 153, 201, 204, 228, 230
- binding pyrophosphate 2-: 31, 32, 33, 34, 35, 36, 155, 411
3qpwA Pfkfb3 in complex with aluminum tetrafluoride (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 238:387/431 of 3qpwA
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 36, 37, 38, 39, 40, 41, 144, 155, 158, 159, 160, 235, 416
- binding phosphoenolpyruvate: 63, 66, 79, 90, 118, 185
5ajxA Human pfkfb3 in complex with an indole inhibitor 3 (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 243:392/441 of 5ajxA
- active site: R249 (= R11), H250 (= H12), N256 (= N18), S299 (≠ R65), E319 (= E92), H384 (= H155)
- binding 6-O-phosphono-beta-D-fructofuranose: I261 (≠ L23), G262 (≠ Q24), E319 (= E92), Y330 (≠ W103), R344 (= R117), K348 (≠ P121), Y359 (= Y132), Q385 (≠ G156), R389 (= R160)
- binding phosphonic acid: R249 (= R11), H250 (= H12), N256 (= N18), H384 (= H155), Q385 (≠ G156)
Sites not aligning to the query:
- binding (2S)-N-[4-[3-cyano-1-[(3,5-dimethyl-1,2-oxazol-4-yl)methyl]indol-5-yl]oxyphenyl]pyrrolidine-2-carboxamide: 42, 43, 46, 47, 211, 214, 215, 218, 235, 236, 238, 240
4ma4A S-glutathionylated pfkfb3 (see paper)
30% identity, 81% coverage: 5:163/196 of query aligns to 237:386/444 of 4ma4A
- active site: R243 (= R11), H244 (= H12), N250 (= N18), S293 (≠ R65), E313 (= E92), H378 (= H155)
- binding 6-O-phosphono-beta-D-fructofuranose: G256 (≠ Q24), E313 (= E92), Y324 (≠ W103), R338 (= R117), K342 (≠ P121), Y353 (= Y132), Q379 (≠ G156), R383 (= R160)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 35, 36, 37, 38, 39, 40, 143, 154, 158, 159, 415
- binding glutathione: 121, 195, 196
Query Sequence
>WP_012170279.1 NCBI__GCF_000010525.1:WP_012170279.1
MTGRRRLFLVRHGETDWNVAGRLQGRRDIPLNSLGRAQAARVGRVLPQLAGEASGLHFVS
SPLGRALETMRILRTTMNLPASDFAHDPQLAELSFGQWEGMTWPEIRRRDTEGVRTRERD
PWSFVPPEGESYAGLAHRAGAAIDRIKGDGVVVTHGGVIRALLHARAGMPANEAAVVPIR
QGAIYVLSDGAFEVKD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory