SitesBLAST
Comparing WP_012171147.1 NCBI__GCF_000010525.1:WP_012171147.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
34% identity, 94% coverage: 24:471/477 of query aligns to 8:478/485 of 2f2aA
- active site: K79 (= K95), S154 (= S170), S155 (= S171), S173 (≠ T189), T175 (= T191), G176 (= G192), G177 (= G193), S178 (= S194), Q181 (≠ W197)
- binding glutamine: G130 (= G146), S154 (= S170), D174 (= D190), T175 (= T191), G176 (= G192), S178 (= S194), F206 (≠ N222), Y309 (vs. gap), Y310 (vs. gap), R358 (= R355), D425 (≠ Q415)
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
34% identity, 94% coverage: 24:471/477 of query aligns to 8:478/485 of 2dqnA
- active site: K79 (= K95), S154 (= S170), S155 (= S171), S173 (≠ T189), T175 (= T191), G176 (= G192), G177 (= G193), S178 (= S194), Q181 (≠ W197)
- binding asparagine: M129 (≠ I145), G130 (= G146), T175 (= T191), G176 (= G192), S178 (= S194), Y309 (vs. gap), Y310 (vs. gap), R358 (= R355), D425 (≠ Q415)
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
31% identity, 94% coverage: 26:474/477 of query aligns to 9:476/478 of 3h0mA
- active site: K72 (= K95), S147 (= S170), S148 (= S171), S166 (≠ T189), T168 (= T191), G169 (= G192), G170 (= G193), S171 (= S194), Q174 (≠ W197)
- binding glutamine: M122 (≠ I145), G123 (= G146), D167 (= D190), T168 (= T191), G169 (= G192), G170 (= G193), S171 (= S194), F199 (≠ N222), Y302 (vs. gap), R351 (= R355), D418 (≠ Q415)
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
31% identity, 94% coverage: 26:474/477 of query aligns to 9:476/478 of 3h0lA
- active site: K72 (= K95), S147 (= S170), S148 (= S171), S166 (≠ T189), T168 (= T191), G169 (= G192), G170 (= G193), S171 (= S194), Q174 (≠ W197)
- binding asparagine: G123 (= G146), S147 (= S170), G169 (= G192), G170 (= G193), S171 (= S194), Y302 (vs. gap), R351 (= R355), D418 (≠ Q415)
3kfuE Crystal structure of the transamidosome (see paper)
36% identity, 94% coverage: 26:474/477 of query aligns to 4:465/468 of 3kfuE
6c6gA An unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. Inhibitor bound complex. (see paper)
35% identity, 92% coverage: 25:464/477 of query aligns to 4:448/457 of 6c6gA
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
31% identity, 89% coverage: 32:457/477 of query aligns to 139:581/616 of 6diiH
- binding methyl-9Z,12Z,15Z-octadecatrienylphosphonofluoridate: G255 (≠ A144), T258 (≠ G147), S281 (= S170), G302 (≠ T191), G303 (= G192), S305 (= S194), S472 (≠ R355), I532 (≠ Q415), M539 (= M419)
Sites not aligning to the query:
Q7XJJ7 Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase; EC 3.5.1.99 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 91% coverage: 32:465/477 of query aligns to 139:589/607 of Q7XJJ7
- K205 (= K95) mutation to A: Loss of activity.
- SS 281:282 (= SS 170:171) mutation to AA: Loss of activity.
- GGGS 302:305 (≠ TGGS 191:194) binding
- S305 (= S194) mutation to A: Loss of activity.
- R307 (= R196) mutation to A: Loss of activity.
- S360 (≠ Y249) mutation to A: No effect.
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
34% identity, 93% coverage: 24:467/477 of query aligns to 8:479/487 of 1m21A
- active site: K81 (= K95), S160 (= S170), S161 (= S171), T179 (= T189), T181 (= T191), D182 (≠ G192), G183 (= G193), S184 (= S194), C187 (≠ W197)
- binding : A129 (= A144), N130 (vs. gap), F131 (≠ I145), C158 (≠ G168), G159 (= G169), S160 (= S170), S184 (= S194), C187 (≠ W197), I212 (≠ N222), R318 (≠ T326), L321 (≠ S329), L365 (≠ D366), F426 (= F410)
3a1iA Crystal structure of rhodococcus sp. N-771 amidase complexed with benzamide (see paper)
33% identity, 78% coverage: 93:465/477 of query aligns to 93:498/508 of 3a1iA
- active site: K95 (= K95), S170 (= S170), S171 (= S171), G189 (≠ T189), Q191 (≠ T191), G192 (= G192), G193 (= G193), A194 (≠ S194), I197 (≠ W197)
- binding benzamide: F145 (≠ I145), S146 (≠ G146), G147 (= G147), Q191 (≠ T191), G192 (= G192), G193 (= G193), A194 (≠ S194), W327 (≠ T326)
Q84DC4 Mandelamide hydrolase; EC 3.5.1.86 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
32% identity, 91% coverage: 26:457/477 of query aligns to 32:480/507 of Q84DC4
- K100 (= K95) mutation to A: Abolishes activity on mandelamide.
- S180 (= S170) mutation to A: Significantly decreases activity on mandelamide.
- S181 (= S171) mutation to A: Significantly decreases activity on mandelamide.
- G202 (= G192) mutation to A: Increase in KM values for aromatic substrates, but not aliphatic substrates. Active against lactamide but not against mandelamide; when associated with H-207 and E-382.; mutation to V: Increase in KM values for aromatic substrates, but not aliphatic substrates.
- S204 (= S194) mutation to A: Abolishes activity on mandelamide.
- Q207 (≠ W197) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with E-382. Active against lactamide but not against mandelamide; when associated with A-202 and E-382. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with S-316 and N-437.
- S316 (vs. gap) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-437.
- Q382 (≠ D366) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with H-207. Active against lactamide but not against mandelamide; when associated with A-202 and H-207.
- I437 (≠ Q415) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with I-31. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-316.
Sites not aligning to the query:
- 31 T→I: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with N-437.
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
29% identity, 92% coverage: 26:465/477 of query aligns to 9:445/457 of 5h6sC
- active site: K77 (= K95), S152 (= S170), S153 (= S171), L173 (≠ T191), G174 (= G192), G175 (= G193), S176 (= S194)
- binding 4-oxidanylbenzohydrazide: C126 (≠ A144), R128 (≠ G146), W129 (≠ G147), S152 (= S170), L173 (≠ T191), G174 (= G192), S176 (= S194), W306 (≠ K325), F338 (vs. gap)
4gysB Granulibacter bethesdensis allophanate hydrolase co-crystallized with malonate (see paper)
31% identity, 90% coverage: 40:468/477 of query aligns to 20:442/461 of 4gysB
- active site: K72 (= K95), S146 (= S170), S147 (= S171), T165 (= T189), T167 (= T191), A168 (≠ G192), G169 (= G193), S170 (= S194), V173 (≠ W197)
- binding malonate ion: A120 (= A144), G122 (= G146), S146 (= S170), T167 (= T191), A168 (≠ G192), S170 (= S194), S193 (≠ R217), G194 (= G218), V195 (= V219), R200 (≠ F224), Y297 (≠ I328), R305 (≠ L333)
Q936X2 Allophanate hydrolase; EC 3.5.1.54 from Pseudomonas sp. (strain ADP) (see paper)
31% identity, 83% coverage: 68:465/477 of query aligns to 61:462/605 of Q936X2
- K91 (= K95) mutation to A: Loss of activity.
- S165 (= S170) mutation to A: Loss of activity.
- S189 (= S194) mutation to A: Loss of activity.
4n0iA Crystal structure of s. Cerevisiae mitochondrial gatfab in complex with glutamine (see paper)
25% identity, 87% coverage: 43:457/477 of query aligns to 3:443/450 of 4n0iA
- active site: K38 (= K95), S116 (= S170), S117 (= S171), T135 (= T189), T137 (= T191), G138 (= G192), G139 (= G193), S140 (= S194), L143 (≠ W197)
- binding glutamine: G89 (= G146), T137 (= T191), G138 (= G192), S140 (= S194), Y168 (≠ N222), Y271 (≠ K325), Y272 (≠ T326), R320 (= R355), D404 (vs. gap)
4yjiA The crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family (see paper)
26% identity, 93% coverage: 26:469/477 of query aligns to 10:478/490 of 4yjiA
- active site: K79 (= K95), S158 (= S170), S159 (= S171), G179 (≠ T191), G180 (= G192), G181 (= G193), A182 (≠ S194)
- binding n-(4-hydroxyphenyl)acetamide (tylenol): L81 (≠ N97), G132 (≠ A144), S158 (= S170), G179 (≠ T191), G180 (= G192), A182 (≠ S194)
3a2qA Structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate (see paper)
34% identity, 53% coverage: 30:282/477 of query aligns to 13:262/482 of 3a2qA
- active site: K69 (= K95), S147 (= S170), S148 (= S171), N166 (≠ T189), A168 (≠ T191), A169 (≠ G192), G170 (= G193), A171 (≠ S194), I174 (≠ W197)
- binding 6-aminohexanoic acid: G121 (≠ A144), G121 (≠ A144), N122 (≠ I145), S147 (= S170), A168 (≠ T191), A168 (≠ T191), A169 (≠ G192), A171 (≠ S194)
Sites not aligning to the query:
1o9oA Crystal structure of the s131a mutant of malonamidase e2 complexed with malonamate from bradyrhizobium japonicum (see paper)
28% identity, 94% coverage: 26:471/477 of query aligns to 6:406/412 of 1o9oA
- active site: K62 (= K95), A131 (≠ S170), S132 (= S171), T150 (= T189), T152 (= T191), G153 (= G192), G154 (= G193), S155 (= S194), R158 (≠ W197)
- binding 3-amino-3-oxopropanoic acid: G130 (= G169), T152 (= T191), G153 (= G192), G154 (= G193), S155 (= S194), R158 (≠ W197), P359 (≠ D409)
1ocmA The crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum (see paper)
29% identity, 94% coverage: 26:471/477 of query aligns to 6:406/412 of 1ocmA
- active site: K62 (= K95), S131 (= S170), S132 (= S171), T152 (= T191), G153 (= G192), G154 (= G193), S155 (= S194)
- binding pyrophosphate 2-: R113 (≠ G146), S131 (= S170), Q151 (≠ D190), T152 (= T191), G153 (= G192), G154 (= G193), S155 (= S194), R158 (≠ W197), P359 (≠ D409)
6te4A Structural insights into pseudomonas aeruginosa type six secretion system exported effector 8: tse8 in complex with a peptide (see paper)
35% identity, 49% coverage: 18:251/477 of query aligns to 1:241/564 of 6te4A
Sites not aligning to the query:
Query Sequence
>WP_012171147.1 NCBI__GCF_000010525.1:WP_012171147.1
MAALELAARERVDVGDTDLVTAGVLELGRMIRTGETSPVEITKACLSRIERIDSKLNSFI
TVTAEAALAQAAAVEAELAAGLDRGPFHGIPYALKDNVDTAGVLSSSHSRIFIDRVPQES
ATVARKLEAAGGILIGKTATFEFAIGGPSFDLPWPPARNPWNPDYLPGGSSSGSGAAVGG
RLVPAAIGTDTGGSIRWPAAMCGITGLKPTYGRISRRGVHPNTFSLDHCGPMARSAADCA
AMLGACAGYDPLDPGSIDAPVPDYTAALTGSIKGLRIGLVRHWYEEEATDEVIAAVDDAV
EVLRQLGAVVEPLTLDPLRDYVDAKTTISITELFAVHEADIRFRPQDFGRLLRSRVMVGG
LVRAEDYVQAMRWRAELSTRMMAAFSRYDLLVTAGWMAPADPAVPDGVDFFKKRQLVTMP
FSLAGLPALALPCGFSSKGLPLSLQIAGRPFDEATVLRAGDAYQQATEWHLAVPNLD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory