Comparing WP_012282524.1 NCBI__GCF_000019165.1:WP_012282524.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
48% identity, 88% coverage: 13:393/432 of query aligns to 2:375/375 of 2eh6A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
48% identity, 88% coverage: 13:393/432 of query aligns to 3:376/376 of O66442
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
46% identity, 89% coverage: 13:396/432 of query aligns to 2:385/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
46% identity, 89% coverage: 13:396/432 of query aligns to 10:393/393 of 2ordA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
45% identity, 86% coverage: 12:382/432 of query aligns to 10:384/401 of 4adbB
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
45% identity, 86% coverage: 12:382/432 of query aligns to 10:384/400 of 4addA
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
44% identity, 86% coverage: 26:398/432 of query aligns to 24:400/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
44% identity, 86% coverage: 26:398/432 of query aligns to 29:405/405 of P40732
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 91% coverage: 5:396/432 of query aligns to 60:456/457 of Q9M8M7
Sites not aligning to the query:
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
44% identity, 86% coverage: 26:398/432 of query aligns to 24:395/397 of 4jewA
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
44% identity, 86% coverage: 26:398/432 of query aligns to 18:389/389 of 2pb0A
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
42% identity, 89% coverage: 11:393/432 of query aligns to 8:383/390 of A0QYS9
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
41% identity, 89% coverage: 13:395/432 of query aligns to 3:387/388 of 3nx3A
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
44% identity, 90% coverage: 11:399/432 of query aligns to 16:399/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
43% identity, 90% coverage: 11:397/432 of query aligns to 10:391/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
43% identity, 90% coverage: 11:397/432 of query aligns to 10:391/391 of 7nn4A
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
40% identity, 90% coverage: 6:394/432 of query aligns to 12:395/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
40% identity, 90% coverage: 6:394/432 of query aligns to 4:387/387 of 1wkhA
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
40% identity, 90% coverage: 6:394/432 of query aligns to 4:387/387 of 1wkgA
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
40% identity, 90% coverage: 6:394/432 of query aligns to 4:387/387 of 1vefA
>WP_012282524.1 NCBI__GCF_000019165.1:WP_012282524.1
MNNAQIVELGKKYVMNTYGRLPISLVKGQGARLWDADGREYLDFLAGLAVNSLGHCHPKV
VDALQQQAATLLHVSNLYWIEPQVQLAQVLVENSFADKVFFCNSGAEANEGAIKLARKYA
KKTWGSDKYEIITMEKSFHGRTLATVTATAQPKYQKDYEPLPQGFRYVPFGDLKALERAI
SPHTCAILVEPVQGEGGVNLAEPSFWQGLAKLAAANKLLLIFDEVQCGLGRTGKLFAHEH
YGVTPHIMTLAKALAGGAPMGALLATDDVANAFQPGDHASTFGGNPLVAAAAVAVMDVLL
NDGLMDNCREMAAYFMGHLRRLQEKYPFITEVRGLGLMVACELDRPGADIVANCLEKGLI
INCTAGNVLRFLPPLIINKADVDEAVAVLEEVLASVVAADAANAASVADAASKANTFSAA
TAKLVPTGGQSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory