SitesBLAST
Comparing WP_012283661.1 NCBI__GCF_000019165.1:WP_012283661.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
37% identity, 100% coverage: 1:333/334 of query aligns to 1:312/315 of Q51742
- M1 (= M1) modified: Initiator methionine, Removed
- W22 (≠ D22) mutation to A: Decreased heat stability.
- E26 (= E26) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ D30) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ Q34) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (≠ I239) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ V262) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E299) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
33% identity, 97% coverage: 8:330/334 of query aligns to 12:308/316 of Q81M99
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
34% identity, 97% coverage: 8:331/334 of query aligns to 3:304/307 of 2i6uA
- active site: R52 (= R59), T53 (= T60), R80 (≠ H87), R101 (= R108), H128 (= H139), Q131 (= Q142), D224 (≠ K241), C264 (≠ A291), R292 (= R319)
- binding phosphoric acid mono(formamide)ester: S50 (= S57), T51 (= T58), R52 (= R59), T53 (= T60), R101 (= R108), C264 (≠ A291), L265 (= L292), R292 (= R319)
- binding norvaline: L123 (≠ Q134), N160 (≠ S171), D224 (≠ K241), S228 (= S245), M229 (≠ W246)
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
34% identity, 97% coverage: 8:331/334 of query aligns to 4:305/308 of 7nouA
- active site: R102 (= R108), H129 (= H139), Q132 (= Q142), D225 (≠ K241), C265 (≠ A291), R293 (= R319)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (≠ M52), T52 (= T58), R53 (= R59), R53 (= R59), F56 (≠ N62), F56 (≠ N62), L79 (≠ I85), D82 (≠ G88), E83 (= E89), V91 (≠ I97), Y95 (≠ F101), L266 (= L292), R293 (= R319)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
34% identity, 97% coverage: 8:331/334 of query aligns to 4:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
34% identity, 97% coverage: 8:331/334 of query aligns to 4:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
34% identity, 97% coverage: 8:331/334 of query aligns to 4:305/308 of 7nnyA
- active site: R102 (= R108), H129 (= H139), Q132 (= Q142), D225 (≠ K241), C265 (≠ A291), R293 (= R319)
- binding 1-naphthol: T52 (= T58), R53 (= R59), F56 (≠ N62), E83 (= E89), V91 (≠ I97), Y95 (≠ F101)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
34% identity, 97% coverage: 8:331/334 of query aligns to 4:305/308 of 7nnwA
- active site: R102 (= R108), H129 (= H139), Q132 (= Q142), D225 (≠ K241), C265 (≠ A291), R293 (= R319)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (≠ M52), T52 (= T58), R53 (= R59), F56 (≠ N62), L79 (≠ I85), L92 (= L98), Y95 (≠ F101)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
34% identity, 97% coverage: 8:331/334 of query aligns to 4:305/308 of 7nnvA
- active site: R102 (= R108), H129 (= H139), Q132 (= Q142), D225 (≠ K241), C265 (≠ A291), R293 (= R319)
- binding phosphoric acid mono(formamide)ester: S51 (= S57), T52 (= T58), R53 (= R59), T54 (= T60), R102 (= R108), H129 (= H139), C265 (≠ A291), L266 (= L292), R293 (= R319)
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
33% identity, 97% coverage: 8:330/334 of query aligns to 8:304/307 of 4nf2A
- active site: R55 (= R59), T56 (= T60), R83 (≠ H87), R104 (= R108), H131 (= H139), Q134 (= Q142), D226 (≠ K241), C265 (≠ A291), R293 (= R319)
- binding phosphoric acid mono(formamide)ester: S53 (= S57), T54 (= T58), R55 (= R59), T56 (= T60), R104 (= R108), H131 (= H139), Q134 (= Q142), C265 (≠ A291), L266 (= L292), R293 (= R319)
- binding norvaline: L126 (≠ Q134), N162 (≠ S177), D226 (≠ K241), S230 (= S245), M231 (≠ W246)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 97% coverage: 8:331/334 of query aligns to 3:304/307 of P9WIT9
7nnzB Crystal structure of mycobacterium tuberculosis argf in complex with 5-methyl-4-phenylthiazol-2-amine.
34% identity, 97% coverage: 8:331/334 of query aligns to 3:294/297 of 7nnzB
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
35% identity, 99% coverage: 2:331/334 of query aligns to 34:342/354 of P00481
- R92 (= R59) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (≠ A291) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
34% identity, 97% coverage: 8:331/334 of query aligns to 4:302/305 of 7np0A
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
35% identity, 98% coverage: 5:331/334 of query aligns to 37:342/354 of P00480
- G39 (= G7) to C: in OTCD; late onset; dbSNP:rs72554306
- R40 (= R8) to H: in OTCD; late onset; dbSNP:rs72554308
- L43 (≠ I11) to F: in dbSNP:rs72554309
- K46 (≠ E14) to R: in dbSNP:rs1800321
- Y55 (≠ T23) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (= L31) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (≠ E55) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 57:60) binding
- G100 (= G67) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ L68) to L: in dbSNP:rs1133135
- L111 (= L78) to P: in dbSNP:rs1800324
- T125 (≠ K92) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D93) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (≠ I96) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (≠ C107) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R108) binding ; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H139) binding
- Q171 (= Q142) binding
- I172 (≠ A143) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ L147) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TM 149:150) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ I154) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (≠ R159) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (≠ A169) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (≠ E170) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ P175) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (= S181) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (≠ P187) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (= M191) to K: in OTCD; late onset
- H214 (≠ D192) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P198) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (= P204) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ V222) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (≠ P240) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (≠ N242) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W243) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G257) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (≠ A258) to R: in dbSNP:rs1800328
- E272 (≠ K260) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (≠ K265) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H290) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (≠ A291) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (≠ AL 291:292) binding
- E309 (≠ N298) natural variant: Missing (in OTCD; late onset)
- R330 (= R319) binding
- T333 (= T322) natural variant: T -> A
- S340 (≠ L329) to P: in OTCD; late onset; dbSNP:rs72558489
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
- 343 T → K: in OTCD; late onset; dbSNP:rs72558491
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
35% identity, 98% coverage: 5:331/334 of query aligns to 4:309/321 of 1othA
- active site: R59 (= R59), T60 (= T60), V87 (≠ H87), R108 (= R108), H135 (= H139), Q138 (= Q142), D230 (≠ K241), C270 (≠ A291), R297 (= R319)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S57), T58 (= T58), R59 (= R59), T60 (= T60), R108 (= R108), L130 (≠ Q134), H135 (= H139), N166 (≠ K173), D230 (≠ K241), S234 (= S245), M235 (≠ A256), C270 (≠ A291), L271 (= L292), R297 (= R319)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
35% identity, 98% coverage: 5:331/334 of query aligns to 4:309/321 of 1c9yA
- active site: R59 (= R59), T60 (= T60), V87 (≠ H87), R108 (= R108), H135 (= H139), Q138 (= Q142), D230 (≠ K241), C270 (≠ A291), R297 (= R319)
- binding phosphoric acid mono(formamide)ester: S57 (= S57), T58 (= T58), R59 (= R59), T60 (= T60), R108 (= R108), C270 (≠ A291), L271 (= L292), R297 (= R319)
- binding norvaline: L130 (≠ Q134), N166 (≠ K173), D230 (≠ K241), S234 (= S245), M235 (≠ A256)
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
34% identity, 97% coverage: 8:331/334 of query aligns to 4:299/302 of 7novA
- active site: R96 (= R108), H123 (= H139), Q126 (= Q142), D219 (≠ K241), C259 (≠ A291), R287 (= R319)
- binding (4-methyl-3-nitro-phenyl)-oxidanyl-oxidanylidene-boron: R53 (= R59), F56 (≠ N62), E77 (= E89), V85 (≠ I97), Y89 (≠ F101), L260 (= L292), A284 (= A316), R287 (= R319)
4jhxA Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine
30% identity, 98% coverage: 5:332/334 of query aligns to 7:335/336 of 4jhxA
- active site: R61 (= R59), T62 (= T60), D89 (≠ H87), R110 (= R108), H137 (= H139), Q140 (= Q142), D235 (≠ K241), C277 (≠ A291), R322 (= R319)
- binding arginine: L132 (≠ Q134), N171 (≠ S177), D235 (≠ K241), S239 (= S254), M240 (≠ V255), P279 (= P293)
- binding phosphoric acid mono(formamide)ester: S59 (= S57), T60 (= T58), R61 (= R59), T62 (= T60), R110 (= R108), H137 (= H139), C277 (≠ A291), L278 (= L292), R322 (= R319)
Q8DCF5 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Vibrio vulnificus (strain CMCP6)
30% identity, 98% coverage: 5:332/334 of query aligns to 5:333/334 of Q8DCF5
Query Sequence
>WP_012283661.1 NCBI__GCF_000019165.1:WP_012283661.1
MQTIFRGRHFIDLEEFTKEEIDTMLEVSFDLKKQFAMGVPTPYLLHKTMFMMFFEQSTRT
RNSMEAGLAQLGGHAGFLDSSSMQIAHGESAKDTAIILSRFGHAIACRYCNWGYGNKYLT
EMARWSKVPIMNLQCDLYHPFQALADLMTMKEKIGDLKRTKVSIIWAYAESHKKPISVPV
SQILLFPRYGMDVCLAHPRGWELPDWVIEKAKANAAKFGGTVTVTNNEEEAYENAHIVIP
KNWGSWVNDQTGASVAGAAKVVDEKLMAQKSWKCTEAKMAMADKDVMYMHALPADRNNEV
EDSVIDGPHSIVFDEAENRLHTAKAVMTLLMGGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory