Comparing WP_012333958.1 NCBI__GCF_000019365.1:WP_012333958.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
38% identity, 94% coverage: 22:426/431 of query aligns to 5:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
38% identity, 94% coverage: 22:426/431 of query aligns to 5:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
31% identity, 95% coverage: 13:423/431 of query aligns to 2:407/412 of 4jbeB
4yweA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
30% identity, 43% coverage: 119:303/431 of query aligns to 127:307/476 of 4yweA
Sites not aligning to the query:
>WP_012333958.1 NCBI__GCF_000019365.1:WP_012333958.1
MSVLSLKPRAGADDVDALMREIGRRARAASRRMALVPARAKDMALRAAAAAIRDAAPVIL
EANAADLAEARGANLPAATLDRLALTPGRVEAIAAAVEAIAGLPDPVGRQLAAFERPNGL
AIERISTPLGVVGVIYESRPNVTADAGALCLKAGNAAVLRAGSESLRSAAAIARAMADGL
AAQGLPAEAIQLVPTRDRAAVGAMLAGLDGCIDVIVPRGGKSLVARVQSEARVPVFAHLE
GICHVFVHARADLAMAREILRNSKLRRTGICGAAETLLVDRACAGTHLAPLVADLLEAGC
AVRGDAETQAVDPRVTPATEADWRTEYLDAVIAVRVVDGLDAAIDHVETYGSHHTDAIVT
ADEAAAERFLAEVDSAIVVHNASTQFADGGEFGFGAEIGIATGRMHARGPVGVEQLTTFK
YRVHGSGQVRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory