Comparing WP_012336037.1 NCBI__GCF_000019365.1:WP_012336037.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P9WQ73 Phosphoserine aminotransferase; Phosphohydroxythreonine aminotransferase; PSAT; EC 2.6.1.52 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
24% identity, 95% coverage: 8:376/390 of query aligns to 16:371/376 of P9WQ73
Sites not aligning to the query:
2fyfA Structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis (see paper)
24% identity, 95% coverage: 8:376/390 of query aligns to 9:363/368 of 2fyfA
Sites not aligning to the query:
3ffrA Crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution
27% identity, 51% coverage: 13:212/390 of query aligns to 6:210/361 of 3ffrA
Sites not aligning to the query:
>WP_012336037.1 NCBI__GCF_000019365.1:WP_012336037.1
MTTRPDARPRAPFFSSGPCAKRPGWTPAALSDAALGRSHRAKLGKAKLKQAIDLTRTVLQ
VPDDYRIGIVPASDTGAVEMAMWSLLGPRPVEMLAWESFGEGWVTDAVKQLRLDARVTTA
PYGALPDLAAVDTRHHDVVFTWNGTTSGVRVPDADWIAADREGVVICDATSAAFAQDLDW
AKLDAVTFSWQKVLGGEAAHGMLILSPRAAARLESHVPAWPMPKIFRMTKGGKLIEGLFE
GETINTPSMLAVEDYIDALLWAQGIGGLPALRARADANARVIAAWVARTPWVENLARAPA
TASNTSVCLVIADPEVTGRGPEAVAALAKGIAATLEREGVALDVGAYRDAPAGLRIWCGA
TVERSDLEALTPWLDWAFAQEKARLLRQAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory